Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2115709..2115934 | Replicon | chromosome |
Accession | NZ_CP018252 | ||
Organism | Escherichia coli strain 9000 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | BFL16_RS11645 | Protein ID | WP_000935259.1 |
Coordinates | 2115709..2115921 (-) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2115876..2115934 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BFL16_RS11595 | 2110712..2111143 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
BFL16_RS11610 | 2111594..2112307 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
BFL16_RS31835 | 2112443..2112640 | - | 198 | WP_000917763.1 | hypothetical protein | - |
BFL16_RS11620 | 2112865..2113419 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
BFL16_RS11625 | 2113482..2113787 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
BFL16_RS11630 | 2113800..2114849 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
BFL16_RS11635 | 2114851..2115123 | - | 273 | WP_000191872.1 | hypothetical protein | - |
BFL16_RS11640 | 2115245..2115589 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
BFL16_RS11645 | 2115709..2115921 | - | 213 | WP_000935259.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 2115876..2115934 | + | 59 | - | - | Antitoxin |
BFL16_RS11650 | 2116155..2116712 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
BFL16_RS11655 | 2116714..2116932 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
BFL16_RS11660 | 2117060..2117371 | - | 312 | WP_001289673.1 | hypothetical protein | - |
BFL16_RS11665 | 2117364..2117591 | - | 228 | WP_000699809.1 | hypothetical protein | - |
BFL16_RS11670 | 2117588..2117869 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
BFL16_RS11675 | 2117902..2118618 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
BFL16_RS31840 | 2118652..2119113 | - | 462 | WP_000139447.1 | replication protein | - |
BFL16_RS31845 | 2119106..2120149 | - | 1044 | WP_001262402.1 | hypothetical protein | - |
BFL16_RS11690 | 2120218..2120643 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
BFL16_RS11695 | 2120627..2120869 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleC / nleG7' / paa | 2031243..2177609 | 146366 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7887.47 Da Isoelectric Point: 9.2654
>T69260 WP_000935259.1 NZ_CP018252:c2115921-2115709 [Escherichia coli]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 213 bp
>T69260 NZ_CP018252:c2115921-2115709 [Escherichia coli]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT69260 NZ_CP018252:2115876-2115934 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|