Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1188878..1189103 | Replicon | chromosome |
| Accession | NZ_CP018252 | ||
| Organism | Escherichia coli strain 9000 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | BFL16_RS06075 | Protein ID | WP_000813263.1 |
| Coordinates | 1188948..1189103 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1188878..1188936 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BFL16_RS06050 | 1184153..1185244 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
| BFL16_RS06055 | 1185251..1185997 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
| BFL16_RS06060 | 1186019..1186789 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| BFL16_RS06065 | 1186805..1187218 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| BFL16_RS06070 | 1187570..1188343 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| BFL16_RS31605 | 1188709..1188846 | - | 138 | WP_000955173.1 | hypothetical protein | - |
| - | 1188878..1188936 | - | 59 | - | - | Antitoxin |
| BFL16_RS06075 | 1188948..1189103 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| BFL16_RS06080 | 1189271..1189549 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| BFL16_RS06085 | 1189551..1190600 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| BFL16_RS06090 | 1190613..1190984 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BFL16_RS06095 | 1190974..1191345 | + | 372 | WP_000090264.1 | antitermination protein | - |
| BFL16_RS06100 | 1191497..1192315 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| BFL16_RS06105 | 1192602..1192798 | + | 197 | Protein_1086 | TrmB family transcriptional regulator | - |
| BFL16_RS06110 | 1192936..1193649 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T69253 WP_000813263.1 NZ_CP018252:1188948-1189103 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T69253 NZ_CP018252:1188948-1189103 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT69253 NZ_CP018252:c1188936-1188878 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|