Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1637851..1638065 | Replicon | chromosome |
Accession | NZ_CP018250 | ||
Organism | Escherichia coli strain 10671 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | BFL17_RS08900 | Protein ID | WP_000170963.1 |
Coordinates | 1637851..1637958 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1638006..1638065 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BFL17_RS08865 | 1633160..1634242 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
BFL17_RS08870 | 1634242..1635075 | + | 834 | WP_072608454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
BFL17_RS08875 | 1635072..1635464 | + | 393 | WP_000200379.1 | invasion regulator SirB2 | - |
BFL17_RS08880 | 1635468..1636277 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
BFL17_RS08885 | 1636313..1637167 | + | 855 | WP_000811067.1 | 3-deoxy-8-phosphooctulonate synthase | - |
BFL17_RS08890 | 1637315..1637422 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1637475..1637536 | + | 62 | NuclAT_24 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_24 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_24 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_24 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_26 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_26 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_26 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_26 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_28 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_28 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_28 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_28 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_30 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_30 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_30 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_30 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_32 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_32 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_32 | - | - |
- | 1637475..1637536 | + | 62 | NuclAT_32 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_17 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_17 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_17 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_17 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_18 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_18 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_18 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_18 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_19 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_19 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_19 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_19 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_20 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_20 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_20 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_20 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_22 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_22 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_22 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_22 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_23 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_23 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_23 | - | - |
- | 1637475..1637537 | + | 63 | NuclAT_23 | - | - |
BFL17_RS08900 | 1637851..1637958 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
- | 1638006..1638065 | + | 60 | NuclAT_25 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_25 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_25 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_25 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_27 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_27 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_27 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_27 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_29 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_29 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_29 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_29 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_31 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_31 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_31 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_31 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_33 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_33 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_33 | - | Antitoxin |
- | 1638006..1638065 | + | 60 | NuclAT_33 | - | Antitoxin |
BFL17_RS08905 | 1638357..1639457 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
BFL17_RS08910 | 1639727..1639957 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
BFL17_RS08915 | 1640118..1640813 | + | 696 | WP_001301489.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
BFL17_RS08920 | 1640857..1641210 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
BFL17_RS08925 | 1641396..1642790 | + | 1395 | WP_000086192.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T69217 WP_000170963.1 NZ_CP018250:c1637958-1637851 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T69217 NZ_CP018250:c1637958-1637851 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT69217 NZ_CP018250:1638006-1638065 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|