Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 4342527..4342748 | Replicon | chromosome |
| Accession | NZ_CP018247 | ||
| Organism | Escherichia coli strain 7784 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | BFL18_RS23935 | Protein ID | WP_001295224.1 |
| Coordinates | 4342527..4342634 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4342683..4342748 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BFL18_RS23910 | 4337780..4338532 | - | 753 | Protein_4239 | cellulose biosynthesis protein BcsQ | - |
| BFL18_RS23915 | 4338544..4338732 | - | 189 | WP_001063316.1 | YhjR family protein | - |
| BFL18_RS23920 | 4339005..4340576 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| BFL18_RS23925 | 4340573..4340764 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| BFL18_RS23930 | 4340761..4342440 | + | 1680 | WP_001691049.1 | cellulose biosynthesis protein BcsG | - |
| BFL18_RS23935 | 4342527..4342634 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4342683..4342748 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 4342683..4342748 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 4342683..4342748 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 4342683..4342748 | + | 66 | NuclAT_16 | - | Antitoxin |
| - | 4342683..4342748 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 4342683..4342748 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 4342683..4342748 | + | 66 | NuclAT_21 | - | Antitoxin |
| - | 4342683..4342748 | + | 66 | NuclAT_21 | - | Antitoxin |
| BFL18_RS23950 | 4343110..4344381 | + | 1272 | WP_001301684.1 | amino acid permease | - |
| BFL18_RS23955 | 4344411..4345415 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BFL18_RS23960 | 4345412..4346395 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| BFL18_RS23965 | 4346406..4347308 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T69199 WP_001295224.1 NZ_CP018247:c4342634-4342527 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T69199 NZ_CP018247:c4342634-4342527 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT69199 NZ_CP018247:4342683-4342748 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|