Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2092087..2092312 | Replicon | chromosome |
| Accession | NZ_CP018247 | ||
| Organism | Escherichia coli strain 7784 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | BFL18_RS11465 | Protein ID | WP_000813258.1 |
| Coordinates | 2092087..2092242 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2092254..2092312 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BFL18_RS11415 | 2087090..2087521 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| BFL18_RS11430 | 2087972..2088685 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| BFL18_RS30775 | 2088821..2089018 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| BFL18_RS11440 | 2089243..2089797 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| BFL18_RS11445 | 2089860..2090165 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BFL18_RS11450 | 2090178..2091227 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| BFL18_RS11455 | 2091229..2091501 | - | 273 | WP_000191872.1 | hypothetical protein | - |
| BFL18_RS11460 | 2091623..2091967 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| BFL18_RS11465 | 2092087..2092242 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 2092254..2092312 | + | 59 | - | - | Antitoxin |
| BFL18_RS11470 | 2092533..2093090 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| BFL18_RS11475 | 2093092..2093310 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| BFL18_RS11480 | 2093438..2093749 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| BFL18_RS11485 | 2093742..2093969 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| BFL18_RS11490 | 2093966..2094247 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| BFL18_RS11495 | 2094280..2094955 | - | 676 | Protein_2035 | DUF1627 domain-containing protein | - |
| BFL18_RS30780 | 2094989..2095450 | - | 462 | WP_000139447.1 | replication protein | - |
| BFL18_RS30785 | 2095443..2096486 | - | 1044 | WP_001262402.1 | hypothetical protein | - |
| BFL18_RS11510 | 2096555..2096980 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| BFL18_RS11515 | 2096964..2097206 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2054972..2113145 | 58173 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T69181 WP_000813258.1 NZ_CP018247:c2092242-2092087 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T69181 NZ_CP018247:c2092242-2092087 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT69181 NZ_CP018247:2092254-2092312 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|