Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1205903..1206128 | Replicon | chromosome |
| Accession | NZ_CP018247 | ||
| Organism | Escherichia coli strain 7784 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | BFL18_RS06185 | Protein ID | WP_000813263.1 |
| Coordinates | 1205973..1206128 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1205903..1205961 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BFL18_RS06160 | 1201160..1202269 | + | 1110 | WP_021499850.1 | putative primosomal protein I | - |
| BFL18_RS06165 | 1202276..1203022 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
| BFL18_RS06170 | 1203044..1203814 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| BFL18_RS06175 | 1203830..1204243 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| BFL18_RS06180 | 1204595..1205368 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| - | 1205903..1205961 | - | 59 | - | - | Antitoxin |
| BFL18_RS06185 | 1205973..1206128 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| BFL18_RS06190 | 1206296..1206574 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| BFL18_RS06195 | 1206576..1207625 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| BFL18_RS06200 | 1207638..1208009 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BFL18_RS06205 | 1207999..1208370 | + | 372 | WP_000090264.1 | antitermination protein | - |
| BFL18_RS06210 | 1208522..1209340 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| BFL18_RS06215 | 1209627..1209823 | + | 197 | Protein_1111 | TrmB family transcriptional regulator | - |
| BFL18_RS06220 | 1209961..1210674 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T69175 WP_000813263.1 NZ_CP018247:1205973-1206128 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T69175 NZ_CP018247:1205973-1206128 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT69175 NZ_CP018247:c1205961-1205903 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|