Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1721998..1722223 | Replicon | chromosome |
Accession | NZ_CP018243 | ||
Organism | Escherichia coli strain 350 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | BFL21_RS09425 | Protein ID | WP_000813258.1 |
Coordinates | 1722068..1722223 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1721998..1722056 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BFL21_RS09380 | 1717052..1717279 | + | 228 | WP_000912298.1 | transcriptional regulator | - |
BFL21_RS09385 | 1717263..1717814 | + | 552 | WP_000705621.1 | hypothetical protein | - |
BFL21_RS30165 | 1717786..1718826 | + | 1041 | WP_140425393.1 | DNA-binding protein | - |
BFL21_RS30885 | 1718738..1719280 | + | 543 | WP_072130322.1 | replication protein | - |
BFL21_RS09395 | 1719314..1720030 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
BFL21_RS09400 | 1720063..1720344 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
BFL21_RS09405 | 1720341..1720568 | + | 228 | WP_000699809.1 | hypothetical protein | - |
BFL21_RS09410 | 1720561..1720872 | + | 312 | WP_001289673.1 | hypothetical protein | - |
BFL21_RS09415 | 1721000..1721218 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
BFL21_RS09420 | 1721220..1721777 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 1721998..1722056 | - | 59 | - | - | Antitoxin |
BFL21_RS09425 | 1722068..1722223 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BFL21_RS09430 | 1722343..1722687 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
BFL21_RS09435 | 1722809..1723081 | + | 273 | WP_000191872.1 | hypothetical protein | - |
BFL21_RS09440 | 1723083..1724132 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
BFL21_RS09445 | 1724145..1724450 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
BFL21_RS09450 | 1724513..1725067 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
BFL21_RS30890 | 1725292..1725489 | + | 198 | WP_000917763.1 | hypothetical protein | - |
BFL21_RS09460 | 1725625..1726338 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
BFL21_RS09475 | 1726789..1727220 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1706018..1759331 | 53313 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T69108 WP_000813258.1 NZ_CP018243:1722068-1722223 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T69108 NZ_CP018243:1722068-1722223 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT69108 NZ_CP018243:c1722056-1721998 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|