Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 4408699..4408920 | Replicon | chromosome |
Accession | NZ_CP018241 | ||
Organism | Escherichia coli strain 319 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | BFL24_RS24125 | Protein ID | WP_001295224.1 |
Coordinates | 4408699..4408806 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4408855..4408920 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BFL24_RS24100 | 4403952..4404704 | - | 753 | Protein_4277 | cellulose biosynthesis protein BcsQ | - |
BFL24_RS24105 | 4404716..4404904 | - | 189 | WP_001063316.1 | YhjR family protein | - |
BFL24_RS24110 | 4405177..4406748 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
BFL24_RS24115 | 4406745..4406936 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
BFL24_RS24120 | 4406933..4408612 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
BFL24_RS24125 | 4408699..4408806 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4408855..4408920 | + | 66 | NuclAT_15 | - | Antitoxin |
- | 4408855..4408920 | + | 66 | NuclAT_15 | - | Antitoxin |
- | 4408855..4408920 | + | 66 | NuclAT_15 | - | Antitoxin |
- | 4408855..4408920 | + | 66 | NuclAT_15 | - | Antitoxin |
- | 4408855..4408920 | + | 66 | NuclAT_20 | - | Antitoxin |
- | 4408855..4408920 | + | 66 | NuclAT_20 | - | Antitoxin |
- | 4408855..4408920 | + | 66 | NuclAT_20 | - | Antitoxin |
- | 4408855..4408920 | + | 66 | NuclAT_20 | - | Antitoxin |
BFL24_RS24140 | 4409282..4410553 | + | 1272 | WP_001301684.1 | amino acid permease | - |
BFL24_RS24145 | 4410583..4411587 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
BFL24_RS24150 | 4411584..4412567 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
BFL24_RS24155 | 4412578..4413480 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T69085 WP_001295224.1 NZ_CP018241:c4408806-4408699 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T69085 NZ_CP018241:c4408806-4408699 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT69085 NZ_CP018241:4408855-4408920 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|