Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1812444..1812669 | Replicon | chromosome |
Accession | NZ_CP018241 | ||
Organism | Escherichia coli strain 319 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | BFL24_RS09925 | Protein ID | WP_000813258.1 |
Coordinates | 1812514..1812669 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1812444..1812502 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BFL24_RS09870 | 1807952..1808413 | + | 462 | WP_000139447.1 | replication protein | - |
BFL24_RS09875 | 1808447..1809163 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
BFL24_RS09880 | 1809196..1809465 | + | 270 | WP_072640384.1 | DNA-binding protein | - |
BFL24_RS09895 | 1809471..1810684 | + | 1214 | WP_162829202.1 | IS3 family transposase | - |
BFL24_RS09905 | 1810787..1811014 | + | 228 | WP_000699809.1 | hypothetical protein | - |
BFL24_RS09910 | 1811007..1811318 | + | 312 | WP_001289673.1 | hypothetical protein | - |
BFL24_RS09915 | 1811446..1811664 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
BFL24_RS09920 | 1811666..1812223 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 1812444..1812502 | - | 59 | - | - | Antitoxin |
BFL24_RS09925 | 1812514..1812669 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BFL24_RS09930 | 1812789..1813133 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
BFL24_RS09935 | 1813255..1813527 | + | 273 | WP_000191872.1 | hypothetical protein | - |
BFL24_RS09940 | 1813529..1814578 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
BFL24_RS09945 | 1814591..1814896 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
BFL24_RS09950 | 1814959..1815513 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
BFL24_RS31120 | 1815738..1815935 | + | 198 | WP_000917763.1 | hypothetical protein | - |
BFL24_RS09960 | 1816071..1816784 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
BFL24_RS09975 | 1817235..1817666 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleG7' | 1748148..1849773 | 101625 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T69065 WP_000813258.1 NZ_CP018241:1812514-1812669 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T69065 NZ_CP018241:1812514-1812669 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT69065 NZ_CP018241:c1812502-1812444 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|