Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1710319..1710533 Replicon chromosome
Accession NZ_CP018241
Organism Escherichia coli strain 319

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag BFL24_RS09250 Protein ID WP_000170963.1
Coordinates 1710319..1710426 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1710474..1710533 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BFL24_RS09215 1705628..1706710 + 1083 WP_000804726.1 peptide chain release factor 1 -
BFL24_RS09220 1706710..1707543 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
BFL24_RS09225 1707540..1707932 + 393 WP_000200379.1 invasion regulator SirB2 -
BFL24_RS09230 1707936..1708745 + 810 WP_001257044.1 invasion regulator SirB1 -
BFL24_RS09235 1708781..1709635 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
BFL24_RS09240 1709783..1709890 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1709943..1710004 + 62 NuclAT_23 - -
- 1709943..1710004 + 62 NuclAT_23 - -
- 1709943..1710004 + 62 NuclAT_23 - -
- 1709943..1710004 + 62 NuclAT_23 - -
- 1709943..1710004 + 62 NuclAT_25 - -
- 1709943..1710004 + 62 NuclAT_25 - -
- 1709943..1710004 + 62 NuclAT_25 - -
- 1709943..1710004 + 62 NuclAT_25 - -
- 1709943..1710004 + 62 NuclAT_27 - -
- 1709943..1710004 + 62 NuclAT_27 - -
- 1709943..1710004 + 62 NuclAT_27 - -
- 1709943..1710004 + 62 NuclAT_27 - -
- 1709943..1710004 + 62 NuclAT_29 - -
- 1709943..1710004 + 62 NuclAT_29 - -
- 1709943..1710004 + 62 NuclAT_29 - -
- 1709943..1710004 + 62 NuclAT_29 - -
- 1709943..1710004 + 62 NuclAT_31 - -
- 1709943..1710004 + 62 NuclAT_31 - -
- 1709943..1710004 + 62 NuclAT_31 - -
- 1709943..1710004 + 62 NuclAT_31 - -
- 1709943..1710005 + 63 NuclAT_16 - -
- 1709943..1710005 + 63 NuclAT_16 - -
- 1709943..1710005 + 63 NuclAT_16 - -
- 1709943..1710005 + 63 NuclAT_16 - -
- 1709943..1710005 + 63 NuclAT_17 - -
- 1709943..1710005 + 63 NuclAT_17 - -
- 1709943..1710005 + 63 NuclAT_17 - -
- 1709943..1710005 + 63 NuclAT_17 - -
- 1709943..1710005 + 63 NuclAT_18 - -
- 1709943..1710005 + 63 NuclAT_18 - -
- 1709943..1710005 + 63 NuclAT_18 - -
- 1709943..1710005 + 63 NuclAT_18 - -
- 1709943..1710005 + 63 NuclAT_19 - -
- 1709943..1710005 + 63 NuclAT_19 - -
- 1709943..1710005 + 63 NuclAT_19 - -
- 1709943..1710005 + 63 NuclAT_19 - -
- 1709943..1710005 + 63 NuclAT_21 - -
- 1709943..1710005 + 63 NuclAT_21 - -
- 1709943..1710005 + 63 NuclAT_21 - -
- 1709943..1710005 + 63 NuclAT_21 - -
- 1709943..1710005 + 63 NuclAT_22 - -
- 1709943..1710005 + 63 NuclAT_22 - -
- 1709943..1710005 + 63 NuclAT_22 - -
- 1709943..1710005 + 63 NuclAT_22 - -
BFL24_RS09250 1710319..1710426 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1710474..1710533 + 60 NuclAT_24 - Antitoxin
- 1710474..1710533 + 60 NuclAT_24 - Antitoxin
- 1710474..1710533 + 60 NuclAT_24 - Antitoxin
- 1710474..1710533 + 60 NuclAT_24 - Antitoxin
- 1710474..1710533 + 60 NuclAT_26 - Antitoxin
- 1710474..1710533 + 60 NuclAT_26 - Antitoxin
- 1710474..1710533 + 60 NuclAT_26 - Antitoxin
- 1710474..1710533 + 60 NuclAT_26 - Antitoxin
- 1710474..1710533 + 60 NuclAT_28 - Antitoxin
- 1710474..1710533 + 60 NuclAT_28 - Antitoxin
- 1710474..1710533 + 60 NuclAT_28 - Antitoxin
- 1710474..1710533 + 60 NuclAT_28 - Antitoxin
- 1710474..1710533 + 60 NuclAT_30 - Antitoxin
- 1710474..1710533 + 60 NuclAT_30 - Antitoxin
- 1710474..1710533 + 60 NuclAT_30 - Antitoxin
- 1710474..1710533 + 60 NuclAT_30 - Antitoxin
- 1710474..1710533 + 60 NuclAT_32 - Antitoxin
- 1710474..1710533 + 60 NuclAT_32 - Antitoxin
- 1710474..1710533 + 60 NuclAT_32 - Antitoxin
- 1710474..1710533 + 60 NuclAT_32 - Antitoxin
BFL24_RS09255 1710825..1711925 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
BFL24_RS09260 1712195..1712425 + 231 WP_001146444.1 putative cation transport regulator ChaB -
BFL24_RS09265 1712586..1713281 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
BFL24_RS09270 1713325..1713678 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
BFL24_RS09275 1713864..1715258 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T69063 WP_000170963.1 NZ_CP018241:c1710426-1710319 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T69063 NZ_CP018241:c1710426-1710319 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT69063 NZ_CP018241:1710474-1710533 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References