Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1229540..1229765 | Replicon | chromosome |
Accession | NZ_CP018241 | ||
Organism | Escherichia coli strain 319 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | BFL24_RS06170 | Protein ID | WP_000813263.1 |
Coordinates | 1229610..1229765 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1229540..1229598 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BFL24_RS06145 | 1224815..1225906 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
BFL24_RS06150 | 1225913..1226659 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
BFL24_RS06155 | 1226681..1227451 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
BFL24_RS06160 | 1227467..1227880 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
BFL24_RS06165 | 1228232..1229005 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
- | 1229540..1229598 | - | 59 | - | - | Antitoxin |
BFL24_RS06170 | 1229610..1229765 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
BFL24_RS06175 | 1229933..1230211 | + | 279 | WP_001341388.1 | hypothetical protein | - |
BFL24_RS06180 | 1230213..1231262 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
BFL24_RS06185 | 1231275..1231646 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
BFL24_RS06190 | 1231636..1232007 | + | 372 | WP_000090264.1 | antitermination protein | - |
BFL24_RS06195 | 1232159..1232977 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
BFL24_RS06200 | 1233264..1233460 | + | 197 | Protein_1105 | TrmB family transcriptional regulator | - |
BFL24_RS06205 | 1233598..1234311 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T69060 WP_000813263.1 NZ_CP018241:1229610-1229765 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T69060 NZ_CP018241:1229610-1229765 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT69060 NZ_CP018241:c1229598-1229540 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|