Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2083197..2083422 | Replicon | chromosome |
Accession | NZ_CP018239 | ||
Organism | Escherichia coli strain 272 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | BFL22_RS11340 | Protein ID | WP_000813258.1 |
Coordinates | 2083197..2083352 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2083364..2083422 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BFL22_RS11290 | 2078200..2078631 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
BFL22_RS11305 | 2079082..2079795 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
BFL22_RS31460 | 2079931..2080128 | - | 198 | WP_000917763.1 | hypothetical protein | - |
BFL22_RS11315 | 2080353..2080907 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
BFL22_RS11320 | 2080970..2081275 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
BFL22_RS11325 | 2081288..2082337 | - | 1050 | WP_072643106.1 | DUF968 domain-containing protein | - |
BFL22_RS11330 | 2082339..2082611 | - | 273 | WP_000191871.1 | hypothetical protein | - |
BFL22_RS11335 | 2082733..2083077 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
BFL22_RS11340 | 2083197..2083352 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 2083364..2083422 | + | 59 | - | - | Antitoxin |
BFL22_RS11345 | 2083643..2084200 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
BFL22_RS11350 | 2084202..2084420 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
BFL22_RS11355 | 2084548..2084859 | - | 312 | WP_001289673.1 | hypothetical protein | - |
BFL22_RS11360 | 2084852..2085079 | - | 228 | WP_000699809.1 | hypothetical protein | - |
BFL22_RS11365 | 2085076..2085357 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
BFL22_RS11370 | 2085390..2086106 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
BFL22_RS31465 | 2086140..2086601 | - | 462 | WP_000139447.1 | replication protein | - |
BFL22_RS31470 | 2086594..2087649 | - | 1056 | WP_001356791.1 | hypothetical protein | - |
BFL22_RS11390 | 2087718..2088143 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
BFL22_RS11395 | 2088127..2088370 | - | 244 | Protein_2011 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2045750..2143910 | 98160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T69023 WP_000813258.1 NZ_CP018239:c2083352-2083197 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T69023 NZ_CP018239:c2083352-2083197 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT69023 NZ_CP018239:2083364-2083422 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|