Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1179520..1179745 | Replicon | chromosome |
| Accession | NZ_CP018239 | ||
| Organism | Escherichia coli strain 272 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | BFL22_RS06000 | Protein ID | WP_000813263.1 |
| Coordinates | 1179590..1179745 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1179520..1179578 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BFL22_RS05975 | 1174795..1175886 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
| BFL22_RS05980 | 1175893..1176639 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
| BFL22_RS05985 | 1176661..1177431 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| BFL22_RS05990 | 1177447..1177860 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| BFL22_RS05995 | 1178212..1178985 | - | 774 | WP_000160650.1 | alpha/beta hydrolase | - |
| - | 1179520..1179578 | - | 59 | - | - | Antitoxin |
| BFL22_RS06000 | 1179590..1179745 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| BFL22_RS06005 | 1179913..1180191 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| BFL22_RS06010 | 1180193..1181242 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| BFL22_RS06015 | 1181255..1181626 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BFL22_RS06020 | 1181616..1181987 | + | 372 | WP_000090264.1 | antitermination protein | - |
| BFL22_RS06025 | 1182139..1182957 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| BFL22_RS06030 | 1183244..1183440 | + | 197 | Protein_1073 | TrmB family transcriptional regulator | - |
| BFL22_RS06035 | 1183578..1184291 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T69017 WP_000813263.1 NZ_CP018239:1179590-1179745 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T69017 NZ_CP018239:1179590-1179745 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT69017 NZ_CP018239:c1179578-1179520 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|