Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1831603..1831785 | Replicon | chromosome |
| Accession | NZ_CP018205 | ||
| Organism | Staphylococcus aureus strain HG001 isolate RN1 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | BSR30_RS15190 | Protein ID | WP_001801861.1 |
| Coordinates | 1831603..1831698 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1831726..1831785 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSR30_RS09275 | 1827263..1827889 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| BSR30_RS09280 | 1827930..1828274 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| BSR30_RS09285 | 1828372..1828923 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| BSR30_RS09290 | 1829141..1829782 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BSR30_RS09295 | 1829896..1830081 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| BSR30_RS09300 | 1830083..1830259 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| BSR30_RS09305 | 1830270..1830653 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| BSR30_RS09320 | 1831257..1831400 | - | 144 | WP_001549059.1 | transposase | - |
| BSR30_RS15190 | 1831603..1831698 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1831726..1831785 | - | 60 | - | - | Antitoxin |
| BSR30_RS09325 | 1831821..1831922 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| BSR30_RS09330 | 1831900..1832076 | - | 177 | Protein_1746 | transposase | - |
| BSR30_RS09335 | 1832270..1832647 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1805576..1864874 | 59298 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T68901 WP_001801861.1 NZ_CP018205:1831603-1831698 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T68901 NZ_CP018205:1831603-1831698 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT68901 NZ_CP018205:c1831785-1831726 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|