Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 73450..73714 | Replicon | plasmid pMRSN346638_119.3 |
| Accession | NZ_CP018116 | ||
| Organism | Escherichia coli strain MRSN346638 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | BSG23_RS25470 | Protein ID | WP_001303307.1 |
| Coordinates | 73562..73714 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 73450..73512 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSG23_RS25455 | 68689..70980 | - | 2292 | WP_001289271.1 | hypothetical protein | - |
| BSG23_RS25460 | 70973..72043 | - | 1071 | WP_000151575.1 | IncI1-type conjugal transfer protein TrbB | - |
| BSG23_RS25465 | 72062..73270 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 73450..73512 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 73450..73512 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 73450..73512 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 73450..73512 | - | 63 | NuclAT_0 | - | Antitoxin |
| BSG23_RS25470 | 73562..73714 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| BSG23_RS25475 | 73786..74037 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - | 74424..74475 | - | 52 | NuclAT_1 | - | - |
| - | 74424..74475 | - | 52 | NuclAT_1 | - | - |
| - | 74424..74475 | - | 52 | NuclAT_1 | - | - |
| - | 74424..74475 | - | 52 | NuclAT_1 | - | - |
| BSG23_RS28730 | 74961..75137 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| BSG23_RS25495 | 75529..75738 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| BSG23_RS25500 | 75810..76472 | - | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| BSG23_RS25505 | 76543..78711 | - | 2169 | WP_071940810.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(A) / erm(42) / floR | - | 1..119254 | 119254 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T68786 WP_001303307.1 NZ_CP018116:73562-73714 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T68786 NZ_CP018116:73562-73714 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT68786 NZ_CP018116:c73512-73450 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|