Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 74522..74786 | Replicon | plasmid pMRSN346595_120.3 |
| Accession | NZ_CP018110 | ||
| Organism | Escherichia coli strain MRSN346595 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | BSG21_RS25455 | Protein ID | WP_001303307.1 |
| Coordinates | 74634..74786 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 74522..74584 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSG21_RS25440 | 69761..72052 | - | 2292 | WP_001289271.1 | hypothetical protein | - |
| BSG21_RS25445 | 72045..73115 | - | 1071 | WP_000151575.1 | IncI1-type conjugal transfer protein TrbB | - |
| BSG21_RS25450 | 73134..74342 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 74522..74584 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 74522..74584 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 74522..74584 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 74522..74584 | - | 63 | NuclAT_0 | - | Antitoxin |
| BSG21_RS25455 | 74634..74786 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| BSG21_RS25460 | 74858..75109 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - | 75496..75547 | - | 52 | NuclAT_1 | - | - |
| - | 75496..75547 | - | 52 | NuclAT_1 | - | - |
| - | 75496..75547 | - | 52 | NuclAT_1 | - | - |
| - | 75496..75547 | - | 52 | NuclAT_1 | - | - |
| BSG21_RS28810 | 76033..76209 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| BSG21_RS25480 | 76601..76810 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| BSG21_RS25485 | 76882..77544 | - | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| BSG21_RS25490 | 77615..79783 | - | 2169 | WP_071940810.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(A) / erm(42) / floR | - | 1..120326 | 120326 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T68753 WP_001303307.1 NZ_CP018110:74634-74786 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T68753 NZ_CP018110:74634-74786 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT68753 NZ_CP018110:c74584-74522 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|