Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2372869..2373053 | Replicon | chromosome |
Accession | NZ_CP017685 | ||
Organism | Staphylococcus aureus strain CFSAN007835 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | AB525_RS12145 | Protein ID | WP_000482647.1 |
Coordinates | 2372946..2373053 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2372869..2372929 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AB525_RS12125 | 2368455..2368622 | - | 168 | WP_031785511.1 | hypothetical protein | - |
AB525_RS12135 | 2368853..2370586 | - | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein/permease | - |
AB525_RS12140 | 2370635..2372374 | - | 1740 | WP_001064831.1 | ABC transporter ATP-binding protein/permease | - |
AB525_RS13620 | 2372752..2372919 | - | 168 | WP_000301894.1 | hypothetical protein | - |
- | 2372869..2372929 | + | 61 | - | - | Antitoxin |
AB525_RS12145 | 2372946..2373053 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
AB525_RS12150 | 2373187..2373573 | - | 387 | WP_000779354.1 | flippase GtxA | - |
AB525_RS12155 | 2373841..2374983 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
AB525_RS12160 | 2375043..2375702 | + | 660 | WP_000831298.1 | membrane protein | - |
AB525_RS12165 | 2375882..2377093 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
AB525_RS12170 | 2377216..2377689 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T68054 WP_000482647.1 NZ_CP017685:c2373053-2372946 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T68054 NZ_CP017685:c2373053-2372946 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT68054 NZ_CP017685:2372869-2372929 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|