Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2070729..2071028 | Replicon | chromosome |
| Accession | NZ_CP017684 | ||
| Organism | Staphylococcus aureus strain CFSAN007847 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | AB520_RS10585 | Protein ID | WP_011447039.1 |
| Coordinates | 2070852..2071028 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2070729..2070784 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB520_RS10540 | 2066059..2066319 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| AB520_RS10545 | 2066372..2066722 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AB520_RS10550 | 2067408..2067857 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AB520_RS10555 | 2067952..2068287 | - | 336 | Protein_1957 | SH3 domain-containing protein | - |
| AB520_RS10565 | 2068937..2069428 | - | 492 | WP_099119664.1 | staphylokinase | - |
| AB520_RS10570 | 2069619..2070374 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AB520_RS10575 | 2070386..2070640 | - | 255 | WP_000611512.1 | phage holin | - |
| AB520_RS10580 | 2070692..2070799 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2070721..2070860 | + | 140 | NuclAT_0 | - | - |
| - | 2070721..2070860 | + | 140 | NuclAT_0 | - | - |
| - | 2070721..2070860 | + | 140 | NuclAT_0 | - | - |
| - | 2070721..2070860 | + | 140 | NuclAT_0 | - | - |
| - | 2070729..2070784 | + | 56 | - | - | Antitoxin |
| AB520_RS10585 | 2070852..2071028 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| AB520_RS10590 | 2071137..2071910 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| AB520_RS10600 | 2072331..2072705 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| AB520_RS10605 | 2072761..2073048 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| AB520_RS10610 | 2073095..2073247 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / tsst-1 / groEL | 2060598..2134325 | 73727 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T68039 WP_011447039.1 NZ_CP017684:c2071028-2070852 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T68039 NZ_CP017684:c2071028-2070852 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT68039 NZ_CP017684:2070729-2070784 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|