Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1868839..1869019 | Replicon | chromosome |
| Accession | NZ_CP017684 | ||
| Organism | Staphylococcus aureus strain CFSAN007847 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AB520_RS14800 | Protein ID | WP_001801861.1 |
| Coordinates | 1868839..1868934 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1868962..1869019 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB520_RS09195 | 1863983..1864609 | + | 627 | WP_000669038.1 | hypothetical protein | - |
| AB520_RS09200 | 1864650..1864994 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| AB520_RS09205 | 1865092..1865664 | + | 573 | WP_000414222.1 | hypothetical protein | - |
| AB520_RS09210 | 1865813..1867180 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| AB520_RS09215 | 1867180..1867749 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AB520_RS09220 | 1867942..1868388 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| AB520_RS14800 | 1868839..1868934 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1868962..1869019 | - | 58 | - | - | Antitoxin |
| AB520_RS09230 | 1869057..1869158 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| AB520_RS09235 | 1869333..1869776 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| AB520_RS09245 | 1871493..1871882 | - | 390 | WP_099119646.1 | DUF1433 domain-containing protein | - |
| AB520_RS09250 | 1871882..1872324 | - | 443 | Protein_1744 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hysA / selk | 1862217..1952199 | 89982 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T68034 WP_001801861.1 NZ_CP017684:1868839-1868934 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T68034 NZ_CP017684:1868839-1868934 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT68034 NZ_CP017684:c1869019-1868962 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|