Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2430353..2430537 | Replicon | chromosome |
Accession | NZ_CP017679 | ||
Organism | Staphylococcus aureus strain CFSAN007883 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | AB478_RS12465 | Protein ID | WP_000482647.1 |
Coordinates | 2430430..2430537 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2430353..2430413 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AB478_RS12445 | 2425863..2426030 | - | 168 | WP_031845053.1 | hypothetical protein | - |
AB478_RS12455 | 2426261..2427994 | - | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein/permease | - |
AB478_RS12460 | 2428019..2429782 | - | 1764 | WP_001064822.1 | ABC transporter ATP-binding protein/permease | - |
AB478_RS14115 | 2430236..2430403 | - | 168 | WP_000301893.1 | hypothetical protein | - |
- | 2430353..2430413 | + | 61 | - | - | Antitoxin |
AB478_RS12465 | 2430430..2430537 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
AB478_RS12470 | 2430670..2431056 | - | 387 | WP_000779353.1 | flippase GtxA | - |
AB478_RS12475 | 2431324..2432466 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
AB478_RS12480 | 2432526..2433185 | + | 660 | WP_000831298.1 | membrane protein | - |
AB478_RS12485 | 2433368..2434579 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
AB478_RS12490 | 2434702..2435175 | - | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T67997 WP_000482647.1 NZ_CP017679:c2430537-2430430 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T67997 NZ_CP017679:c2430537-2430430 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT67997 NZ_CP017679:2430353-2430413 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|