Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2129724..2129940 | Replicon | chromosome |
Accession | NZ_CP017677 | ||
Organism | Staphylococcus aureus strain CFSAN007894 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | AB466_RS10915 | Protein ID | WP_001802298.1 |
Coordinates | 2129836..2129940 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2129724..2129779 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AB466_RS10895 | 2125930..2126595 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
AB466_RS10900 | 2126747..2127067 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
AB466_RS10905 | 2127069..2128046 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
AB466_RS10910 | 2128312..2129403 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
- | 2129724..2129779 | + | 56 | - | - | Antitoxin |
AB466_RS10915 | 2129836..2129940 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
AB466_RS10925 | 2130620..2130778 | + | 159 | WP_001792784.1 | hypothetical protein | - |
AB466_RS10935 | 2131436..2132293 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
AB466_RS10940 | 2132361..2133143 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T67984 WP_001802298.1 NZ_CP017677:c2129940-2129836 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T67984 NZ_CP017677:c2129940-2129836 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT67984 NZ_CP017677:2129724-2129779 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|