Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1958375..1958674 | Replicon | chromosome |
Accession | NZ_CP017677 | ||
Organism | Staphylococcus aureus strain CFSAN007894 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | AB466_RS09920 | Protein ID | WP_072353918.1 |
Coordinates | 1958498..1958674 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1958375..1958430 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AB466_RS09860 | 1953933..1954112 | + | 180 | WP_000669791.1 | hypothetical protein | - |
AB466_RS09870 | 1954423..1954683 | + | 261 | WP_001791826.1 | hypothetical protein | - |
AB466_RS09875 | 1954736..1955086 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
AB466_RS09880 | 1955597..1955932 | - | 336 | Protein_1824 | SH3 domain-containing protein | - |
AB466_RS09900 | 1956583..1957074 | - | 492 | WP_000920038.1 | staphylokinase | - |
AB466_RS09905 | 1957265..1958020 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
AB466_RS09910 | 1958032..1958286 | - | 255 | WP_000611512.1 | phage holin | - |
AB466_RS09915 | 1958338..1958445 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1958367..1958506 | + | 140 | NuclAT_0 | - | - |
- | 1958367..1958506 | + | 140 | NuclAT_0 | - | - |
- | 1958367..1958506 | + | 140 | NuclAT_0 | - | - |
- | 1958367..1958506 | + | 140 | NuclAT_0 | - | - |
- | 1958375..1958430 | + | 56 | - | - | Antitoxin |
AB466_RS09920 | 1958498..1958674 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
AB466_RS09925 | 1958817..1959191 | - | 375 | WP_000340977.1 | hypothetical protein | - |
AB466_RS09930 | 1959247..1959534 | - | 288 | WP_001262620.1 | hypothetical protein | - |
AB466_RS09935 | 1959580..1959732 | - | 153 | WP_001000058.1 | hypothetical protein | - |
AB466_RS09940 | 1959725..1963507 | - | 3783 | WP_000582132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1954736..2005726 | 50990 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T67979 WP_072353918.1 NZ_CP017677:c1958674-1958498 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T67979 NZ_CP017677:c1958674-1958498 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT67979 NZ_CP017677:1958375-1958430 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|