Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 64586..64839 | Replicon | plasmid pSLK172-2 |
Accession | NZ_CP017633 | ||
Organism | Escherichia coli strain SLK172 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | BJJ90_RS31360 | Protein ID | WP_001312851.1 |
Coordinates | 64586..64735 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 64780..64839 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BJJ90_RS31310 | 59945..60360 | - | 416 | Protein_69 | IS1 family transposase | - |
BJJ90_RS31320 | 60609..61010 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
BJJ90_RS33585 | 60943..61200 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
BJJ90_RS31330 | 61293..61946 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
BJJ90_RS33750 | 62044..62184 | - | 141 | WP_001333237.1 | hypothetical protein | - |
BJJ90_RS31340 | 62885..63742 | - | 858 | WP_075362754.1 | incFII family plasmid replication initiator RepA | - |
BJJ90_RS31345 | 63735..63809 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
BJJ90_RS31355 | 64054..64302 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
BJJ90_RS31360 | 64586..64735 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 64780..64839 | + | 60 | NuclAT_1 | - | Antitoxin |
- | 64780..64839 | + | 60 | NuclAT_1 | - | Antitoxin |
- | 64780..64839 | + | 60 | NuclAT_1 | - | Antitoxin |
- | 64780..64839 | + | 60 | NuclAT_1 | - | Antitoxin |
BJJ90_RS31365 | 65040..65270 | - | 231 | WP_001736714.1 | hypothetical protein | - |
BJJ90_RS31370 | 65434..66033 | - | 600 | WP_032083981.1 | hypothetical protein | - |
BJJ90_RS31375 | 66419..66619 | - | 201 | WP_015059022.1 | hypothetical protein | - |
BJJ90_RS31380 | 66751..67311 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
BJJ90_RS31385 | 67366..68112 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / blaTEM-1B / fosA3 / oqxA / oqxB / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | - | 1..120528 | 120528 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T67847 WP_001312851.1 NZ_CP017633:c64735-64586 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T67847 NZ_CP017633:c64735-64586 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT67847 NZ_CP017633:64780-64839 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|