Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 981254..981415 | Replicon | chromosome |
Accession | NZ_CP017463 | ||
Organism | Staphylococcus pasteuri strain JS7 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | BJG87_RS04875 | Protein ID | WP_107999723.1 |
Coordinates | 981254..981349 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 981381..981415 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BJG87_RS04865 | 977189..980122 | + | 2934 | WP_096807774.1 | AAA family ATPase | - |
BJG87_RS04870 | 980122..981063 | + | 942 | WP_017638040.1 | 3'-5' exoribonuclease YhaM | - |
BJG87_RS04875 | 981254..981349 | + | 96 | WP_107999723.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 981381..981415 | - | 35 | - | - | Antitoxin |
BJG87_RS04880 | 981509..982501 | - | 993 | WP_029056284.1 | peptidylprolyl isomerase | - |
BJG87_RS04885 | 982684..983241 | - | 558 | WP_029056283.1 | DUF3267 domain-containing protein | - |
BJG87_RS04890 | 983437..983808 | - | 372 | WP_017638293.1 | YtxH domain-containing protein | - |
BJG87_RS04895 | 983886..984311 | - | 426 | WP_017638294.1 | HIT family protein | - |
BJG87_RS04900 | 984443..985183 | + | 741 | WP_017638295.1 | ABC transporter ATP-binding protein | - |
BJG87_RS04905 | 985176..986399 | + | 1224 | WP_096807776.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3656.34 Da Isoelectric Point: 8.0878
>T66839 WP_107999723.1 NZ_CP017463:981254-981349 [Staphylococcus pasteuri]
MSEIFVHIMTTVISGCIVTLFAHWLRHRNDK
MSEIFVHIMTTVISGCIVTLFAHWLRHRNDK
Download Length: 96 bp
>T66839 NZ_CP017463:981254-981349 [Staphylococcus pasteuri]
ATGTCTGAAATCTTTGTTCATATTATGACTACTGTTATCAGTGGTTGTATTGTTACGTTGTTTGCACATTGGCTACGGCA
TCGTAACGATAAGTAA
ATGTCTGAAATCTTTGTTCATATTATGACTACTGTTATCAGTGGTTGTATTGTTACGTTGTTTGCACATTGGCTACGGCA
TCGTAACGATAAGTAA
Antitoxin
Download Length: 35 bp
>AT66839 NZ_CP017463:c981415-981381 [Staphylococcus pasteuri]
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|