Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3493281..3493506 | Replicon | chromosome |
Accession | NZ_CP017438 | ||
Organism | Escherichia coli O157:H7 strain 2159 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | A4C45_RS18435 | Protein ID | WP_000813263.1 |
Coordinates | 3493281..3493436 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3493448..3493506 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A4C45_RS18400 | 3488735..3489448 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
A4C45_RS18405 | 3489586..3489782 | - | 197 | Protein_3476 | TrmB family transcriptional regulator | - |
A4C45_RS18410 | 3490069..3490887 | - | 819 | WP_000265269.1 | CPBP family intramembrane metalloprotease | - |
A4C45_RS18415 | 3491039..3491410 | - | 372 | WP_000090264.1 | antitermination protein | - |
A4C45_RS18420 | 3491400..3491771 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
A4C45_RS18425 | 3491784..3492833 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
A4C45_RS29800 | 3492835..3493113 | - | 279 | WP_001341388.1 | hypothetical protein | - |
A4C45_RS18435 | 3493281..3493436 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3493448..3493506 | + | 59 | - | - | Antitoxin |
A4C45_RS18440 | 3494041..3494814 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
A4C45_RS18445 | 3495166..3495579 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
A4C45_RS18450 | 3495595..3496365 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
A4C45_RS18455 | 3496387..3497133 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
A4C45_RS18460 | 3497140..3498231 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T66616 WP_000813263.1 NZ_CP017438:c3493436-3493281 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T66616 NZ_CP017438:c3493436-3493281 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT66616 NZ_CP017438:3493448-3493506 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|