Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 52151..52420 | Replicon | plasmid pKPGJ-3c |
| Accession | NZ_CP017287 | ||
| Organism | Klebsiella variicola strain GJ3 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BBD65_RS01655 | Protein ID | WP_001312861.1 |
| Coordinates | 52262..52420 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 52151..52216 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBD65_RS01630 | 47861..48388 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| BBD65_RS01635 | 48446..48679 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| BBD65_RS01640 | 48740..50763 | + | 2024 | Protein_65 | ParB/RepB/Spo0J family partition protein | - |
| BBD65_RS01645 | 50832..51266 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| BBD65_RS01650 | 51263..51982 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 51994..52218 | + | 225 | NuclAT_0 | - | - |
| - | 51994..52218 | + | 225 | NuclAT_0 | - | - |
| - | 51994..52218 | + | 225 | NuclAT_0 | - | - |
| - | 51994..52218 | + | 225 | NuclAT_0 | - | - |
| - | 52151..52216 | + | 66 | - | - | Antitoxin |
| BBD65_RS01655 | 52262..52420 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BBD65_RS31400 | 52658..53035 | - | 378 | Protein_69 | hypothetical protein | - |
| BBD65_RS01675 | 53335..53631 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| BBD65_RS01680 | 53742..54563 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| BBD65_RS01685 | 54860..55462 | - | 603 | WP_077143832.1 | transglycosylase SLT domain-containing protein | - |
| BBD65_RS01690 | 55785..56168 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| BBD65_RS01695 | 56362..56745 | + | 384 | Protein_74 | conjugal transfer protein TrbJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aph(3')-Ia / mph(A) / blaCTX-M-65 / fosA3 / blaTEM-215 | - | 1..73385 | 73385 | |
| - | flank | IS/Tn | - | - | 56897..58165 | 1268 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T66398 WP_001312861.1 NZ_CP017287:52262-52420 [Klebsiella variicola]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T66398 NZ_CP017287:52262-52420 [Klebsiella variicola]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT66398 NZ_CP017287:52151-52216 [Klebsiella variicola]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|