Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 101840..102073 | Replicon | plasmid pFAM21845_1 |
| Accession | NZ_CP017221 | ||
| Organism | Escherichia coli strain FAM21845 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BHT24_RS26465 | Protein ID | WP_001312861.1 |
| Coordinates | 101840..101998 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 102042..102073 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BHT24_RS26420 | 97213..97902 | - | 690 | WP_000283383.1 | conjugal transfer transcriptional regulator TraJ | - |
| BHT24_RS26425 | 98089..98472 | - | 384 | WP_001151528.1 | relaxosome protein TraM | - |
| BHT24_RS26430 | 98793..99395 | + | 603 | WP_000243710.1 | transglycosylase SLT domain-containing protein | - |
| BHT24_RS26435 | 99692..100513 | - | 822 | WP_001234423.1 | DUF945 domain-containing protein | - |
| BHT24_RS26440 | 100633..100830 | - | 198 | WP_052318758.1 | hypothetical protein | - |
| BHT24_RS26450 | 101186..101398 | - | 213 | WP_001208963.1 | hypothetical protein | - |
| BHT24_RS26465 | 101840..101998 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 102042..102073 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 102042..102073 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 102042..102073 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 102042..102073 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 103515..103712 | - | 198 | NuclAT_0 | - | - |
| - | 103515..103712 | - | 198 | NuclAT_0 | - | - |
| - | 103515..103712 | - | 198 | NuclAT_0 | - | - |
| - | 103515..103712 | - | 198 | NuclAT_0 | - | - |
| BHT24_RS27940 | 103524..103712 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| BHT24_RS26475 | 103724..104443 | - | 720 | WP_081178411.1 | plasmid SOS inhibition protein A | - |
| BHT24_RS26480 | 104440..104874 | - | 435 | WP_000845932.1 | conjugation system SOS inhibitor PsiB | - |
| BHT24_RS26490 | 104929..106887 | - | 1959 | Protein_122 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / aph(4)-Ia / aac(3)-IVa / dfrA1 / ant(3'')-Ia / qacE / sul1 / blaTEM-1A / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..147225 | 147225 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T66250 WP_001312861.1 NZ_CP017221:c101998-101840 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T66250 NZ_CP017221:c101998-101840 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT66250 NZ_CP017221:c102073-102042 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|