Detailed information of TA system TA066245

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 62130..62384
• Replicon: plasmid pFAM21845_1
• Accession: NZ_CP017221
• Organism: Escherichia coli strain FAM21845

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: BHT24_RS26215
• Protein ID: WP_001553767.1
• Coordinates: 62130..62336 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	62323..62384 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BHT24_RS26170	57292..57989	-	698	Protein_63	IS1 family transposase	-
BHT24_RS26180	58152..58553	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
BHT24_RS27735	58486..58743	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
BHT24_RS26185	58836..59489	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
BHT24_RS28085	59587..59727	-	141	WP_001333237.1	hypothetical protein	-
BHT24_RS26195	60427..61284	-	858	WP_000131010.1	incFII family plasmid replication initiator RepA	-
BHT24_RS26200	61277..61351	-	75	WP_001365705.1	RepA leader peptide Tap	-
BHT24_RS26210	61598..61846	-	249	WP_000083835.1	replication regulatory protein RepA	-
BHT24_RS26215	62130..62336	-	207	WP_001553767.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	62323..62384	+	62	NuclAT_2	-	Antitoxin
-	62323..62384	+	62	NuclAT_2	-	Antitoxin
-	62323..62384	+	62	NuclAT_2	-	Antitoxin
-	62323..62384	+	62	NuclAT_2	-	Antitoxin
BHT24_RS26225	62559..62941	-	383	Protein_72	hypothetical protein	-
BHT24_RS26230	63044..63505	-	462	WP_000760078.1	thermonuclease family protein	-
BHT24_RS26235	64248..64451	-	204	WP_001327131.1	hypothetical protein	-
BHT24_RS26240	64606..65163	-	558	WP_000139312.1	fertility inhibition protein FinO	-
BHT24_RS26245	65266..66126	-	861	WP_000704512.1	alpha/beta hydrolase	-
BHT24_RS26250	66185..66931	-	747	WP_000205745.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / aph(4)-Ia / aac(3)-IVa / dfrA1 / ant(3'')-Ia / qacE / sul1 / blaTEM-1A / sitABCD	iutA / iucD / iucC / iucB / iucA	1..147225	147225
	-	flank	IS/Tn	-	-	57292..57669	377

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7804.35 Da
• Isoelectric Point: 8.8807

>T66245 WP_001553767.1 NZ_CP017221:c62336-62130 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T66245 NZ_CP017221:c62336-62130 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GGTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTTACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 62 bp

>AT66245 NZ_CP017221:62323-62384 [Escherichia coli]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin