Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2490896..2491080 | Replicon | chromosome |
Accession | NZ_CP017115 | ||
Organism | Staphylococcus aureus strain FORC_045 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | FORC45_RS13055 | Protein ID | WP_000482647.1 |
Coordinates | 2490973..2491080 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2490896..2490956 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC45_RS13030 | 2486370..2486537 | - | 168 | WP_001790576.1 | hypothetical protein | - |
FORC45_RS13040 | 2486768..2488501 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
FORC45_RS13045 | 2488526..2490289 | - | 1764 | WP_088607410.1 | ABC transporter ATP-binding protein/permease | - |
- | 2490896..2490956 | + | 61 | - | - | Antitoxin |
FORC45_RS13055 | 2490973..2491080 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
FORC45_RS13060 | 2491214..2491600 | - | 387 | WP_000779360.1 | flippase GtxA | - |
FORC45_RS13065 | 2491858..2493000 | + | 1143 | WP_001176871.1 | glycerate kinase | - |
FORC45_RS13070 | 2493060..2493719 | + | 660 | WP_000831301.1 | membrane protein | - |
FORC45_RS13075 | 2493901..2495112 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
FORC45_RS13080 | 2495235..2495708 | - | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T66048 WP_000482647.1 NZ_CP017115:c2491080-2490973 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T66048 NZ_CP017115:c2491080-2490973 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT66048 NZ_CP017115:2490896-2490956 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|