Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3640526..3640748 | Replicon | chromosome |
Accession | NZ_CP017100 | ||
Organism | Escherichia coli strain K-12 NEB 5-alpha |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | NEB5A_RS18105 | Protein ID | WP_000141634.1 |
Coordinates | 3640526..3640633 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3640682..3640748 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NEB5A_RS18080 | 3635779..3636531 | - | 753 | Protein_3465 | cellulose biosynthesis protein BcsQ | - |
NEB5A_RS18085 | 3636543..3636731 | - | 189 | WP_001063318.1 | YhjR family protein | - |
NEB5A_RS18090 | 3637004..3638575 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
NEB5A_RS18095 | 3638572..3638763 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
NEB5A_RS18100 | 3638760..3640439 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
NEB5A_RS18105 | 3640526..3640633 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 3640682..3640748 | + | 67 | - | - | Antitoxin |
NEB5A_RS18115 | 3641109..3642380 | + | 1272 | WP_001295225.1 | transporter | - |
NEB5A_RS18120 | 3642410..3643414 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
NEB5A_RS18125 | 3643411..3644394 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
NEB5A_RS18130 | 3644405..3645307 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T65996 WP_000141634.1 NZ_CP017100:c3640633-3640526 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T65996 NZ_CP017100:c3640633-3640526 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT65996 NZ_CP017100:3640682-3640748 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|