Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1167431..1167653 Replicon chromosome
Accession NZ_CP017100
Organism Escherichia coli strain K-12 NEB 5-alpha

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag NEB5A_RS05845 Protein ID WP_000170963.1
Coordinates 1167431..1167538 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1167586..1167653 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NEB5A_RS05815 1162740..1163822 + 1083 WP_000804726.1 peptide chain release factor 1 -
NEB5A_RS05820 1163822..1164655 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
NEB5A_RS05825 1164652..1165044 + 393 WP_000200374.1 invasion regulator SirB2 -
NEB5A_RS05830 1165048..1165857 + 810 WP_001257044.1 invasion regulator SirB1 -
NEB5A_RS05835 1165893..1166747 + 855 WP_046613400.1 3-deoxy-8-phosphooctulonate synthase -
NEB5A_RS05840 1166896..1167003 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1167051..1167117 + 67 NuclAT_34 - -
- 1167051..1167117 + 67 NuclAT_34 - -
- 1167051..1167117 + 67 NuclAT_34 - -
- 1167051..1167117 + 67 NuclAT_34 - -
- 1167051..1167117 + 67 NuclAT_36 - -
- 1167051..1167117 + 67 NuclAT_36 - -
- 1167051..1167117 + 67 NuclAT_36 - -
- 1167051..1167117 + 67 NuclAT_36 - -
- 1167051..1167117 + 67 NuclAT_38 - -
- 1167051..1167117 + 67 NuclAT_38 - -
- 1167051..1167117 + 67 NuclAT_38 - -
- 1167051..1167117 + 67 NuclAT_38 - -
- 1167051..1167117 + 67 NuclAT_40 - -
- 1167051..1167117 + 67 NuclAT_40 - -
- 1167051..1167117 + 67 NuclAT_40 - -
- 1167051..1167117 + 67 NuclAT_40 - -
- 1167051..1167117 + 67 NuclAT_42 - -
- 1167051..1167117 + 67 NuclAT_42 - -
- 1167051..1167117 + 67 NuclAT_42 - -
- 1167051..1167117 + 67 NuclAT_42 - -
- 1167051..1167117 + 67 NuclAT_44 - -
- 1167051..1167117 + 67 NuclAT_44 - -
- 1167051..1167117 + 67 NuclAT_44 - -
- 1167051..1167117 + 67 NuclAT_44 - -
- 1167053..1167118 + 66 NuclAT_18 - -
- 1167053..1167118 + 66 NuclAT_18 - -
- 1167053..1167118 + 66 NuclAT_18 - -
- 1167053..1167118 + 66 NuclAT_18 - -
- 1167053..1167118 + 66 NuclAT_21 - -
- 1167053..1167118 + 66 NuclAT_21 - -
- 1167053..1167118 + 66 NuclAT_21 - -
- 1167053..1167118 + 66 NuclAT_21 - -
- 1167053..1167118 + 66 NuclAT_24 - -
- 1167053..1167118 + 66 NuclAT_24 - -
- 1167053..1167118 + 66 NuclAT_24 - -
- 1167053..1167118 + 66 NuclAT_24 - -
- 1167053..1167118 + 66 NuclAT_27 - -
- 1167053..1167118 + 66 NuclAT_27 - -
- 1167053..1167118 + 66 NuclAT_27 - -
- 1167053..1167118 + 66 NuclAT_27 - -
- 1167053..1167118 + 66 NuclAT_30 - -
- 1167053..1167118 + 66 NuclAT_30 - -
- 1167053..1167118 + 66 NuclAT_30 - -
- 1167053..1167118 + 66 NuclAT_30 - -
- 1167053..1167118 + 66 NuclAT_33 - -
- 1167053..1167118 + 66 NuclAT_33 - -
- 1167053..1167118 + 66 NuclAT_33 - -
- 1167053..1167118 + 66 NuclAT_33 - -
NEB5A_RS05845 1167431..1167538 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1167586..1167653 + 68 NuclAT_17 - Antitoxin
- 1167586..1167653 + 68 NuclAT_17 - Antitoxin
- 1167586..1167653 + 68 NuclAT_17 - Antitoxin
- 1167586..1167653 + 68 NuclAT_17 - Antitoxin
- 1167586..1167653 + 68 NuclAT_20 - Antitoxin
- 1167586..1167653 + 68 NuclAT_20 - Antitoxin
- 1167586..1167653 + 68 NuclAT_20 - Antitoxin
- 1167586..1167653 + 68 NuclAT_20 - Antitoxin
- 1167586..1167653 + 68 NuclAT_23 - Antitoxin
- 1167586..1167653 + 68 NuclAT_23 - Antitoxin
- 1167586..1167653 + 68 NuclAT_23 - Antitoxin
- 1167586..1167653 + 68 NuclAT_23 - Antitoxin
- 1167586..1167653 + 68 NuclAT_26 - Antitoxin
- 1167586..1167653 + 68 NuclAT_26 - Antitoxin
- 1167586..1167653 + 68 NuclAT_26 - Antitoxin
- 1167586..1167653 + 68 NuclAT_26 - Antitoxin
- 1167586..1167653 + 68 NuclAT_29 - Antitoxin
- 1167586..1167653 + 68 NuclAT_29 - Antitoxin
- 1167586..1167653 + 68 NuclAT_29 - Antitoxin
- 1167586..1167653 + 68 NuclAT_29 - Antitoxin
- 1167586..1167653 + 68 NuclAT_32 - Antitoxin
- 1167586..1167653 + 68 NuclAT_32 - Antitoxin
- 1167586..1167653 + 68 NuclAT_32 - Antitoxin
- 1167586..1167653 + 68 NuclAT_32 - Antitoxin
- 1167587..1167652 + 66 NuclAT_35 - -
- 1167587..1167652 + 66 NuclAT_35 - -
- 1167587..1167652 + 66 NuclAT_35 - -
- 1167587..1167652 + 66 NuclAT_35 - -
- 1167587..1167652 + 66 NuclAT_37 - -
- 1167587..1167652 + 66 NuclAT_37 - -
- 1167587..1167652 + 66 NuclAT_37 - -
- 1167587..1167652 + 66 NuclAT_37 - -
- 1167587..1167652 + 66 NuclAT_39 - -
- 1167587..1167652 + 66 NuclAT_39 - -
- 1167587..1167652 + 66 NuclAT_39 - -
- 1167587..1167652 + 66 NuclAT_39 - -
- 1167587..1167652 + 66 NuclAT_41 - -
- 1167587..1167652 + 66 NuclAT_41 - -
- 1167587..1167652 + 66 NuclAT_41 - -
- 1167587..1167652 + 66 NuclAT_41 - -
- 1167587..1167652 + 66 NuclAT_43 - -
- 1167587..1167652 + 66 NuclAT_43 - -
- 1167587..1167652 + 66 NuclAT_43 - -
- 1167587..1167652 + 66 NuclAT_43 - -
- 1167587..1167652 + 66 NuclAT_45 - -
- 1167587..1167652 + 66 NuclAT_45 - -
- 1167587..1167652 + 66 NuclAT_45 - -
- 1167587..1167652 + 66 NuclAT_45 - -
NEB5A_RS05850 1167966..1168073 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1168121..1168188 + 68 NuclAT_16 - -
- 1168121..1168188 + 68 NuclAT_16 - -
- 1168121..1168188 + 68 NuclAT_16 - -
- 1168121..1168188 + 68 NuclAT_16 - -
- 1168121..1168188 + 68 NuclAT_19 - -
- 1168121..1168188 + 68 NuclAT_19 - -
- 1168121..1168188 + 68 NuclAT_19 - -
- 1168121..1168188 + 68 NuclAT_19 - -
- 1168121..1168188 + 68 NuclAT_22 - -
- 1168121..1168188 + 68 NuclAT_22 - -
- 1168121..1168188 + 68 NuclAT_22 - -
- 1168121..1168188 + 68 NuclAT_22 - -
- 1168121..1168188 + 68 NuclAT_25 - -
- 1168121..1168188 + 68 NuclAT_25 - -
- 1168121..1168188 + 68 NuclAT_25 - -
- 1168121..1168188 + 68 NuclAT_25 - -
- 1168121..1168188 + 68 NuclAT_28 - -
- 1168121..1168188 + 68 NuclAT_28 - -
- 1168121..1168188 + 68 NuclAT_28 - -
- 1168121..1168188 + 68 NuclAT_28 - -
- 1168121..1168188 + 68 NuclAT_31 - -
- 1168121..1168188 + 68 NuclAT_31 - -
- 1168121..1168188 + 68 NuclAT_31 - -
- 1168121..1168188 + 68 NuclAT_31 - -
NEB5A_RS05855 1168477..1169577 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
NEB5A_RS05860 1169847..1170077 + 231 WP_001146444.1 putative cation transport regulator ChaB -
NEB5A_RS05865 1170235..1170930 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
NEB5A_RS05870 1170974..1171327 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T65966 WP_000170963.1 NZ_CP017100:c1167538-1167431 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T65966 NZ_CP017100:c1167538-1167431 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT65966 NZ_CP017100:1167586-1167653 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References