Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 141935..142117 | Replicon | chromosome |
Accession | NZ_CP017094 | ||
Organism | Staphylococcus aureus strain 2148.C01 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | A7U45_RS15215 | Protein ID | WP_001801861.1 |
Coordinates | 142022..142117 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 141935..141994 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7U45_RS00915 | 141073..141450 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
A7U45_RS00920 | 141644..141820 | + | 177 | Protein_130 | transposase | - |
A7U45_RS00925 | 141798..141899 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 141935..141994 | + | 60 | - | - | Antitoxin |
A7U45_RS15215 | 142022..142117 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
A7U45_RS00935 | 142320..142463 | + | 144 | WP_001549059.1 | transposase | - |
A7U45_RS00945 | 143067..143450 | + | 384 | WP_000070811.1 | hypothetical protein | - |
A7U45_RS00950 | 143461..143637 | + | 177 | WP_000375476.1 | hypothetical protein | - |
A7U45_RS00955 | 143639..143824 | + | 186 | WP_000809857.1 | hypothetical protein | - |
A7U45_RS00960 | 143938..144579 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
A7U45_RS00965 | 144797..145348 | - | 552 | WP_000414205.1 | hypothetical protein | - |
A7U45_RS00970 | 145446..145790 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
A7U45_RS00975 | 145831..146457 | - | 627 | Protein_140 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 123415..168156 | 44741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T65939 WP_001801861.1 NZ_CP017094:c142117-142022 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T65939 NZ_CP017094:c142117-142022 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT65939 NZ_CP017094:141935-141994 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|