Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2546035..2546219 | Replicon | chromosome |
Accession | NZ_CP017090 | ||
Organism | Staphylococcus aureus strain ISU935 isolate ST5 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | A2V17_RS13165 | Protein ID | WP_000482652.1 |
Coordinates | 2546112..2546219 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2546035..2546095 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A2V17_RS13140 | 2541490..2541657 | - | 168 | Protein_2450 | hypothetical protein | - |
A2V17_RS13150 | 2541888..2543621 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
A2V17_RS13155 | 2543646..2545409 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2546035..2546095 | + | 61 | - | - | Antitoxin |
A2V17_RS13165 | 2546112..2546219 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
A2V17_RS13170 | 2546353..2546739 | - | 387 | WP_000779360.1 | flippase GtxA | - |
A2V17_RS13175 | 2547007..2548149 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
A2V17_RS13180 | 2548209..2548868 | + | 660 | WP_088401739.1 | hypothetical protein | - |
A2V17_RS13185 | 2549050..2550261 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
A2V17_RS13190 | 2550384..2550857 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T65922 WP_000482652.1 NZ_CP017090:c2546219-2546112 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T65922 NZ_CP017090:c2546219-2546112 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT65922 NZ_CP017090:2546035-2546095 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|