Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 35779..36032 | Replicon | plasmid pT18 |
| Accession | NZ_CP017086 | ||
| Organism | Proteus mirabilis strain T18 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | BG029_RS19810 | Protein ID | WP_001312851.1 |
| Coordinates | 35883..36032 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 35779..35838 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BG029_RS19765 | 31439..31504 | - | 66 | Protein_37 | helix-turn-helix domain-containing protein | - |
| BG029_RS19770 | 31557..32261 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| BG029_RS19780 | 32506..33252 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| BG029_RS19785 | 33307..33867 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| BG029_RS19790 | 33999..34199 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| BG029_RS19795 | 34585..35184 | + | 600 | WP_032083981.1 | hypothetical protein | - |
| - | 35779..35838 | - | 60 | NuclAT_0 | - | Antitoxin |
| - | 35779..35838 | - | 60 | NuclAT_0 | - | Antitoxin |
| - | 35779..35838 | - | 60 | NuclAT_0 | - | Antitoxin |
| - | 35779..35838 | - | 60 | NuclAT_0 | - | Antitoxin |
| BG029_RS19810 | 35883..36032 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BG029_RS19815 | 36316..36564 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| BG029_RS19825 | 36809..36883 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| BG029_RS19830 | 36876..37733 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| BG029_RS19840 | 38672..39325 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| BG029_RS20195 | 39418..39675 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| BG029_RS19845 | 39608..40009 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| BG029_RS19855 | 40258..40673 | + | 416 | Protein_50 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / rmtB / blaTEM-1B / fosA3 | - | 1..59035 | 59035 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T65888 WP_001312851.1 NZ_CP017086:35883-36032 [Proteus mirabilis]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T65888 NZ_CP017086:35883-36032 [Proteus mirabilis]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT65888 NZ_CP017086:c35838-35779 [Proteus mirabilis]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|