Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1019339..1019521 | Replicon | chromosome |
Accession | NZ_CP016863 | ||
Organism | Staphylococcus aureus strain 1625.C01 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | A7Q05_RS15305 | Protein ID | WP_001801861.1 |
Coordinates | 1019426..1019521 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1019339..1019398 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7Q05_RS05805 | 1018477..1018854 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
A7Q05_RS05810 | 1019048..1019224 | + | 177 | Protein_1018 | transposase | - |
A7Q05_RS05815 | 1019202..1019303 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 1019339..1019398 | + | 60 | - | - | Antitoxin |
A7Q05_RS15305 | 1019426..1019521 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
A7Q05_RS05825 | 1019724..1019867 | + | 144 | WP_001549059.1 | transposase | - |
A7Q05_RS05835 | 1020471..1020854 | + | 384 | WP_000070811.1 | hypothetical protein | - |
A7Q05_RS05840 | 1020865..1021041 | + | 177 | WP_000375476.1 | hypothetical protein | - |
A7Q05_RS05845 | 1021043..1021228 | + | 186 | WP_000809857.1 | hypothetical protein | - |
A7Q05_RS05850 | 1021342..1021983 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
A7Q05_RS05855 | 1022201..1022752 | - | 552 | WP_000414205.1 | hypothetical protein | - |
A7Q05_RS05860 | 1022850..1023194 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
A7Q05_RS05865 | 1023235..1023861 | - | 627 | Protein_1028 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlgA / lukD | 986250..1045560 | 59310 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T65305 WP_001801861.1 NZ_CP016863:c1019521-1019426 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T65305 NZ_CP016863:c1019521-1019426 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT65305 NZ_CP016863:1019339-1019398 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|