Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2314760..2314942 | Replicon | chromosome |
| Accession | NZ_CP016861 | ||
| Organism | Staphylococcus aureus strain 1969.N | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | A7U52_RS15415 | Protein ID | WP_001801861.1 |
| Coordinates | 2314847..2314942 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2314760..2314819 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7U52_RS12570 | 2313898..2314275 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| A7U52_RS12575 | 2314469..2314645 | + | 177 | Protein_2251 | transposase | - |
| A7U52_RS12580 | 2314623..2314724 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 2314760..2314819 | + | 60 | - | - | Antitoxin |
| A7U52_RS15415 | 2314847..2314942 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| A7U52_RS12590 | 2315145..2315288 | + | 144 | WP_001549059.1 | transposase | - |
| A7U52_RS12600 | 2315892..2316275 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| A7U52_RS12605 | 2316286..2316462 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| A7U52_RS12610 | 2316464..2316649 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| A7U52_RS12615 | 2316763..2317404 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A7U52_RS12620 | 2317622..2318173 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| A7U52_RS12625 | 2318271..2318615 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| A7U52_RS12630 | 2318656..2319282 | - | 627 | Protein_2261 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 2281671..2352395 | 70724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T65289 WP_001801861.1 NZ_CP016861:c2314942-2314847 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T65289 NZ_CP016861:c2314942-2314847 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT65289 NZ_CP016861:2314760-2314819 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|