Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1689046..1689230 | Replicon | chromosome |
Accession | NZ_CP016861 | ||
Organism | Staphylococcus aureus strain 1969.N |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | A7U52_RS08910 | Protein ID | WP_000482650.1 |
Coordinates | 1689046..1689153 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1689170..1689230 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7U52_RS08885 | 1684408..1684881 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
A7U52_RS08890 | 1685004..1686215 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
A7U52_RS08895 | 1686397..1687056 | - | 660 | WP_000831298.1 | membrane protein | - |
A7U52_RS08900 | 1687116..1688258 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
A7U52_RS08905 | 1688526..1688912 | + | 387 | WP_000779358.1 | flippase GtxA | - |
A7U52_RS08910 | 1689046..1689153 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1689170..1689230 | - | 61 | - | - | Antitoxin |
A7U52_RS08920 | 1689781..1691544 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
A7U52_RS08925 | 1691569..1693302 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
A7U52_RS08935 | 1693533..1693700 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T65276 WP_000482650.1 NZ_CP016861:1689046-1689153 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T65276 NZ_CP016861:1689046-1689153 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT65276 NZ_CP016861:c1689230-1689170 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|