Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2323628..2323810 | Replicon | chromosome |
| Accession | NZ_CP016858 | ||
| Organism | Staphylococcus aureus strain 1971.C01 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | A7U47_RS15475 | Protein ID | WP_001801861.1 |
| Coordinates | 2323715..2323810 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2323628..2323687 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7U47_RS12560 | 2322766..2323143 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| A7U47_RS12565 | 2323337..2323513 | + | 177 | Protein_2274 | transposase | - |
| A7U47_RS12570 | 2323491..2323592 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 2323628..2323687 | + | 60 | - | - | Antitoxin |
| A7U47_RS15475 | 2323715..2323810 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| A7U47_RS12580 | 2324013..2324156 | + | 144 | WP_001549059.1 | transposase | - |
| A7U47_RS12590 | 2324760..2325143 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| A7U47_RS12595 | 2325154..2325330 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| A7U47_RS12600 | 2325332..2325517 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| A7U47_RS12605 | 2325631..2326272 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A7U47_RS12610 | 2326490..2327041 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| A7U47_RS12615 | 2327139..2327483 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| A7U47_RS12620 | 2327524..2328150 | - | 627 | Protein_2284 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 2290539..2361263 | 70724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T65272 WP_001801861.1 NZ_CP016858:c2323810-2323715 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T65272 NZ_CP016858:c2323810-2323715 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT65272 NZ_CP016858:2323628-2323687 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|