Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2308766..2308946 | Replicon | chromosome |
Accession | NZ_CP016856 | ||
Organism | Staphylococcus aureus strain 2148.N |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | A7U44_RS14220 | Protein ID | WP_001801861.1 |
Coordinates | 2308851..2308946 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2308766..2308823 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7U44_RS12025 | 2305117..2306235 | + | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
A7U44_RS12030 | 2306883..2307299 | + | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
A7U44_RS12035 | 2307536..2307883 | + | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
A7U44_RS12040 | 2307905..2308279 | + | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
A7U44_RS12045 | 2308467..2308649 | + | 183 | Protein_2219 | transposase | - |
A7U44_RS12050 | 2308627..2308728 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 2308766..2308823 | + | 58 | - | - | Antitoxin |
A7U44_RS14220 | 2308851..2308946 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
A7U44_RS12060 | 2309397..2309843 | + | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
A7U44_RS12065 | 2310528..2310911 | + | 384 | WP_000070811.1 | hypothetical protein | - |
A7U44_RS12070 | 2310922..2311098 | + | 177 | WP_000375476.1 | hypothetical protein | - |
A7U44_RS12080 | 2311469..2312026 | + | 558 | WP_103672653.1 | ImmA/IrrE family metallo-endopeptidase | - |
A7U44_RS12085 | 2312224..2312796 | - | 573 | WP_000414206.1 | hypothetical protein | - |
A7U44_RS12090 | 2312897..2313238 | - | 342 | WP_000627547.1 | DUF3969 family protein | - |
A7U44_RS12095 | 2313279..2313905 | - | 627 | WP_000669021.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / hlgA / lukD | 2279870..2316463 | 36593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T65255 WP_001801861.1 NZ_CP016856:c2308946-2308851 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T65255 NZ_CP016856:c2308946-2308851 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT65255 NZ_CP016856:2308766-2308823 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|