Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1691434..1691618 | Replicon | chromosome |
Accession | NZ_CP016856 | ||
Organism | Staphylococcus aureus strain 2148.N |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | A7U44_RS08455 | Protein ID | WP_000482650.1 |
Coordinates | 1691434..1691541 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1691558..1691618 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7U44_RS08430 | 1686806..1687279 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
A7U44_RS08435 | 1687402..1688613 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
A7U44_RS08440 | 1688795..1689454 | - | 660 | WP_000831298.1 | membrane protein | - |
A7U44_RS08445 | 1689514..1690656 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
A7U44_RS08450 | 1690914..1691300 | + | 387 | WP_000779358.1 | flippase GtxA | - |
A7U44_RS08455 | 1691434..1691541 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1691558..1691618 | - | 61 | - | - | Antitoxin |
A7U44_RS08465 | 1692189..1693952 | + | 1764 | WP_001064820.1 | ABC transporter ATP-binding protein/permease | - |
A7U44_RS08470 | 1693977..1695710 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
A7U44_RS08480 | 1695941..1696108 | + | 168 | WP_001792506.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T65242 WP_000482650.1 NZ_CP016856:1691434-1691541 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T65242 NZ_CP016856:1691434-1691541 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT65242 NZ_CP016856:c1691618-1691558 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|