Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 185246..185428 | Replicon | chromosome |
| Accession | NZ_CP016855 | ||
| Organism | Staphylococcus aureus strain 5118.N | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | A7U51_RS01530 | Protein ID | WP_001801861.1 |
| Coordinates | 185333..185428 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 185246..185305 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7U51_RS01515 | 184384..184761 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| A7U51_RS01520 | 184955..185131 | + | 177 | Protein_198 | transposase | - |
| A7U51_RS01525 | 185109..185210 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 185246..185305 | + | 60 | - | - | Antitoxin |
| A7U51_RS01530 | 185333..185428 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| A7U51_RS01540 | 185631..185774 | + | 144 | WP_001549059.1 | transposase | - |
| A7U51_RS01550 | 186378..186761 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| A7U51_RS01555 | 186772..186948 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| A7U51_RS01560 | 186950..187135 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| A7U51_RS01565 | 187249..187890 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A7U51_RS01570 | 188108..188659 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| A7U51_RS01575 | 188757..189101 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| A7U51_RS01580 | 189142..189768 | - | 627 | Protein_208 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 152156..222881 | 70725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T65224 WP_001801861.1 NZ_CP016855:c185428-185333 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T65224 NZ_CP016855:c185428-185333 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT65224 NZ_CP016855:185246-185305 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|