Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2213032..2213257 | Replicon | chromosome |
| Accession | NZ_CP016625 | ||
| Organism | Escherichia coli O157:H7 strain FRIK944 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | A9L45_RS11365 | Protein ID | WP_000813254.1 |
| Coordinates | 2213032..2213187 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2213199..2213257 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9L45_RS11335 | 2208794..2208991 | - | 198 | WP_000917735.1 | hypothetical protein | - |
| A9L45_RS11340 | 2209218..2210039 | - | 822 | WP_000762902.1 | antitermination protein | - |
| A9L45_RS11345 | 2210036..2210410 | - | 375 | WP_000904171.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A9L45_RS11350 | 2210423..2211472 | - | 1050 | WP_001265189.1 | DUF968 domain-containing protein | - |
| A9L45_RS31380 | 2211474..2211743 | - | 270 | WP_024177817.1 | hypothetical protein | - |
| A9L45_RS31385 | 2211797..2212024 | - | 228 | WP_001452497.1 | hypothetical protein | - |
| A9L45_RS11355 | 2212248..2212619 | + | 372 | WP_001217944.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| A9L45_RS11360 | 2212612..2212929 | + | 318 | WP_000042395.1 | DNA-binding transcriptional regulator | - |
| A9L45_RS11365 | 2213032..2213187 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2213199..2213257 | + | 59 | - | - | Antitoxin |
| A9L45_RS11370 | 2213459..2214007 | - | 549 | WP_000211435.1 | ORF6N domain-containing protein | - |
| A9L45_RS11375 | 2214355..2214540 | - | 186 | WP_000215514.1 | hypothetical protein | - |
| A9L45_RS11380 | 2214600..2215358 | - | 759 | WP_000537579.1 | DUF1627 domain-containing protein | - |
| A9L45_RS34600 | 2215393..2215935 | - | 543 | WP_157837342.1 | replication protein | - |
| A9L45_RS34605 | 2215847..2216887 | - | 1041 | WP_000020565.1 | DNA-binding protein | - |
| A9L45_RS11395 | 2216859..2217410 | - | 552 | WP_000705370.1 | hypothetical protein | - |
| A9L45_RS11400 | 2217394..2217621 | - | 228 | WP_000476986.1 | transcriptional regulator | - |
| A9L45_RS11405 | 2217699..2218106 | + | 408 | WP_001003379.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ospG | 2177165..2337493 | 160328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T64884 WP_000813254.1 NZ_CP016625:c2213187-2213032 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T64884 NZ_CP016625:c2213187-2213032 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATTGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATTGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT64884 NZ_CP016625:2213199-2213257 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|