Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1826998..1827178 | Replicon | chromosome |
| Accession | NZ_CP016398 | ||
| Organism | Staphylococcus aureus strain FORC_040 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FORC40_RS14265 | Protein ID | WP_001801861.1 |
| Coordinates | 1826998..1827093 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1827121..1827178 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC40_RS08995 | 1822039..1822665 | + | 627 | WP_000669021.1 | hypothetical protein | - |
| FORC40_RS09000 | 1822706..1823047 | + | 342 | WP_000627547.1 | DUF3969 family protein | - |
| FORC40_RS09005 | 1823148..1823720 | + | 573 | WP_000414206.1 | hypothetical protein | - |
| FORC40_RS09010 | 1823918..1824475 | - | 558 | WP_000864139.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FORC40_RS09020 | 1824846..1825022 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| FORC40_RS09025 | 1825033..1825416 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| FORC40_RS09030 | 1826101..1826547 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
| FORC40_RS14265 | 1826998..1827093 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1827121..1827178 | - | 58 | - | - | Antitoxin |
| FORC40_RS09040 | 1827216..1827317 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| FORC40_RS09045 | 1827295..1827477 | - | 183 | Protein_1699 | transposase | - |
| FORC40_RS09050 | 1827665..1828039 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
| FORC40_RS09055 | 1828061..1828408 | - | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
| FORC40_RS09060 | 1828645..1829061 | - | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
| FORC40_RS09065 | 1829708..1830826 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1797464..1854329 | 56865 | |
| - | inside | Prophage | - | lukD / hlgA / selk | 1801182..1856997 | 55815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T64557 WP_001801861.1 NZ_CP016398:1826998-1827093 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T64557 NZ_CP016398:1826998-1827093 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT64557 NZ_CP016398:c1827178-1827121 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|