Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2397131..2397353 | Replicon | chromosome |
Accession | NZ_CP016358 | ||
Organism | Escherichia coli strain K-15KW01 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | BA058_RS27345 | Protein ID | WP_001295224.1 |
Coordinates | 2397131..2397238 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2397287..2397353 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BA058_RS11600 | 2392384..2393136 | - | 753 | WP_000279536.1 | cellulose biosynthesis protein BcsQ | - |
BA058_RS11605 | 2393148..2393336 | - | 189 | WP_001063314.1 | YhjR family protein | - |
BA058_RS11610 | 2393609..2395180 | + | 1572 | WP_001204945.1 | cellulose biosynthesis protein BcsE | - |
BA058_RS11615 | 2395177..2395368 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
BA058_RS11620 | 2395365..2397044 | + | 1680 | WP_000191565.1 | cellulose biosynthesis protein BcsG | - |
BA058_RS27345 | 2397131..2397238 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2397287..2397353 | + | 67 | - | - | Antitoxin |
BA058_RS11635 | 2397714..2398985 | + | 1272 | WP_001298005.1 | amino acid permease | - |
BA058_RS11640 | 2399015..2400019 | - | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
BA058_RS11645 | 2400016..2400999 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
BA058_RS11650 | 2401010..2401912 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T64512 WP_001295224.1 NZ_CP016358:c2397238-2397131 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T64512 NZ_CP016358:c2397238-2397131 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT64512 NZ_CP016358:2397287-2397353 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|