Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 31046..31310 | Replicon | plasmid pS51_1 |
Accession | NZ_CP015996 | ||
Organism | Escherichia coli strain S51 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | A9K64_RS25195 | Protein ID | WP_001331364.1 |
Coordinates | 31046..31198 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 31253..31310 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A9K64_RS25165 | 26324..28486 | + | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
A9K64_RS25170 | 28551..29213 | + | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
A9K64_RS25175 | 29285..29494 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
A9K64_RS29525 | 29886..30062 | + | 177 | WP_001054904.1 | hypothetical protein | - |
A9K64_RS25190 | 30127..30423 | - | 297 | WP_001275298.1 | hypothetical protein | - |
A9K64_RS25195 | 31046..31198 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
- | 31253..31310 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 31253..31310 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 31253..31310 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 31253..31310 | + | 58 | NuclAT_0 | - | Antitoxin |
A9K64_RS25200 | 31490..32698 | + | 1209 | WP_000121274.1 | IncI1-type conjugal transfer protein TrbA | - |
A9K64_RS25205 | 32717..33787 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
A9K64_RS25210 | 33780..36071 | + | 2292 | WP_001289276.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1A | - | 1..93029 | 93029 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T64082 WP_001331364.1 NZ_CP015996:c31198-31046 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T64082 NZ_CP015996:c31198-31046 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT64082 NZ_CP015996:31253-31310 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|