Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2041527..2041747 | Replicon | chromosome |
| Accession | NZ_CP015995 | ||
| Organism | Escherichia coli strain S51 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | A9K64_RS10325 | Protein ID | WP_000170965.1 |
| Coordinates | 2041527..2041634 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2041681..2041747 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9K64_RS10295 | 2037382..2038215 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| A9K64_RS10300 | 2038212..2038604 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| A9K64_RS10305 | 2038608..2039417 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| A9K64_RS10310 | 2039453..2040307 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| A9K64_RS10315 | 2040456..2040563 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2040611..2040677 | + | 67 | NuclAT_50 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_50 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_50 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_50 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_53 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_53 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_53 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_53 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_56 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_56 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_56 | - | - |
| - | 2040611..2040677 | + | 67 | NuclAT_56 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_15 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_15 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_15 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_15 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_18 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_18 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_18 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_18 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_21 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_21 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_21 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_21 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_24 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_24 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_24 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_24 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_27 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_27 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_27 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_27 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_30 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_30 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_30 | - | - |
| - | 2040613..2040676 | + | 64 | NuclAT_30 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_33 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_33 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_33 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_33 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_36 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_36 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_36 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_36 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_39 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_39 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_39 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_39 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_42 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_42 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_42 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_42 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_45 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_45 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_45 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_45 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_48 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_48 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_48 | - | - |
| - | 2040613..2040678 | + | 66 | NuclAT_48 | - | - |
| A9K64_RS29000 | 2040991..2041098 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2041151..2041212 | + | 62 | NuclAT_16 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_16 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_16 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_16 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_19 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_19 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_19 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_19 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_22 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_22 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_22 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_22 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_25 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_25 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_25 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_25 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_28 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_28 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_28 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_28 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_31 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_31 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_31 | - | - |
| - | 2041151..2041212 | + | 62 | NuclAT_31 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_51 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_51 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_51 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_51 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_54 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_54 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_54 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_54 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_57 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_57 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_57 | - | - |
| - | 2041151..2041213 | + | 63 | NuclAT_57 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_34 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_34 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_34 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_34 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_37 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_37 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_37 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_37 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_40 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_40 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_40 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_40 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_43 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_43 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_43 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_43 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_46 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_46 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_46 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_46 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_49 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_49 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_49 | - | - |
| - | 2041151..2041214 | + | 64 | NuclAT_49 | - | - |
| A9K64_RS10325 | 2041527..2041634 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2041681..2041747 | + | 67 | - | - | Antitoxin |
| A9K64_RS10330 | 2042039..2043139 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| A9K64_RS10335 | 2043409..2043639 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| A9K64_RS10340 | 2043797..2044492 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| A9K64_RS10345 | 2044536..2044889 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| A9K64_RS10350 | 2045074..2046468 | + | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T64060 WP_000170965.1 NZ_CP015995:c2041634-2041527 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T64060 NZ_CP015995:c2041634-2041527 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT64060 NZ_CP015995:2041681-2041747 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|