Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2041527..2041747 Replicon chromosome
Accession NZ_CP015995
Organism Escherichia coli strain S51

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag A9K64_RS10325 Protein ID WP_000170965.1
Coordinates 2041527..2041634 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2041681..2041747 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A9K64_RS10295 2037382..2038215 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
A9K64_RS10300 2038212..2038604 + 393 WP_000200392.1 invasion regulator SirB2 -
A9K64_RS10305 2038608..2039417 + 810 WP_001257044.1 invasion regulator SirB1 -
A9K64_RS10310 2039453..2040307 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
A9K64_RS10315 2040456..2040563 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2040611..2040677 + 67 NuclAT_50 - -
- 2040611..2040677 + 67 NuclAT_50 - -
- 2040611..2040677 + 67 NuclAT_50 - -
- 2040611..2040677 + 67 NuclAT_50 - -
- 2040611..2040677 + 67 NuclAT_53 - -
- 2040611..2040677 + 67 NuclAT_53 - -
- 2040611..2040677 + 67 NuclAT_53 - -
- 2040611..2040677 + 67 NuclAT_53 - -
- 2040611..2040677 + 67 NuclAT_56 - -
- 2040611..2040677 + 67 NuclAT_56 - -
- 2040611..2040677 + 67 NuclAT_56 - -
- 2040611..2040677 + 67 NuclAT_56 - -
- 2040613..2040676 + 64 NuclAT_15 - -
- 2040613..2040676 + 64 NuclAT_15 - -
- 2040613..2040676 + 64 NuclAT_15 - -
- 2040613..2040676 + 64 NuclAT_15 - -
- 2040613..2040676 + 64 NuclAT_18 - -
- 2040613..2040676 + 64 NuclAT_18 - -
- 2040613..2040676 + 64 NuclAT_18 - -
- 2040613..2040676 + 64 NuclAT_18 - -
- 2040613..2040676 + 64 NuclAT_21 - -
- 2040613..2040676 + 64 NuclAT_21 - -
- 2040613..2040676 + 64 NuclAT_21 - -
- 2040613..2040676 + 64 NuclAT_21 - -
- 2040613..2040676 + 64 NuclAT_24 - -
- 2040613..2040676 + 64 NuclAT_24 - -
- 2040613..2040676 + 64 NuclAT_24 - -
- 2040613..2040676 + 64 NuclAT_24 - -
- 2040613..2040676 + 64 NuclAT_27 - -
- 2040613..2040676 + 64 NuclAT_27 - -
- 2040613..2040676 + 64 NuclAT_27 - -
- 2040613..2040676 + 64 NuclAT_27 - -
- 2040613..2040676 + 64 NuclAT_30 - -
- 2040613..2040676 + 64 NuclAT_30 - -
- 2040613..2040676 + 64 NuclAT_30 - -
- 2040613..2040676 + 64 NuclAT_30 - -
- 2040613..2040678 + 66 NuclAT_33 - -
- 2040613..2040678 + 66 NuclAT_33 - -
- 2040613..2040678 + 66 NuclAT_33 - -
- 2040613..2040678 + 66 NuclAT_33 - -
- 2040613..2040678 + 66 NuclAT_36 - -
- 2040613..2040678 + 66 NuclAT_36 - -
- 2040613..2040678 + 66 NuclAT_36 - -
- 2040613..2040678 + 66 NuclAT_36 - -
- 2040613..2040678 + 66 NuclAT_39 - -
- 2040613..2040678 + 66 NuclAT_39 - -
- 2040613..2040678 + 66 NuclAT_39 - -
- 2040613..2040678 + 66 NuclAT_39 - -
- 2040613..2040678 + 66 NuclAT_42 - -
- 2040613..2040678 + 66 NuclAT_42 - -
- 2040613..2040678 + 66 NuclAT_42 - -
- 2040613..2040678 + 66 NuclAT_42 - -
- 2040613..2040678 + 66 NuclAT_45 - -
- 2040613..2040678 + 66 NuclAT_45 - -
- 2040613..2040678 + 66 NuclAT_45 - -
- 2040613..2040678 + 66 NuclAT_45 - -
- 2040613..2040678 + 66 NuclAT_48 - -
- 2040613..2040678 + 66 NuclAT_48 - -
- 2040613..2040678 + 66 NuclAT_48 - -
- 2040613..2040678 + 66 NuclAT_48 - -
A9K64_RS29000 2040991..2041098 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2041151..2041212 + 62 NuclAT_16 - -
- 2041151..2041212 + 62 NuclAT_16 - -
- 2041151..2041212 + 62 NuclAT_16 - -
- 2041151..2041212 + 62 NuclAT_16 - -
- 2041151..2041212 + 62 NuclAT_19 - -
- 2041151..2041212 + 62 NuclAT_19 - -
- 2041151..2041212 + 62 NuclAT_19 - -
- 2041151..2041212 + 62 NuclAT_19 - -
- 2041151..2041212 + 62 NuclAT_22 - -
- 2041151..2041212 + 62 NuclAT_22 - -
- 2041151..2041212 + 62 NuclAT_22 - -
- 2041151..2041212 + 62 NuclAT_22 - -
- 2041151..2041212 + 62 NuclAT_25 - -
- 2041151..2041212 + 62 NuclAT_25 - -
- 2041151..2041212 + 62 NuclAT_25 - -
- 2041151..2041212 + 62 NuclAT_25 - -
- 2041151..2041212 + 62 NuclAT_28 - -
- 2041151..2041212 + 62 NuclAT_28 - -
- 2041151..2041212 + 62 NuclAT_28 - -
- 2041151..2041212 + 62 NuclAT_28 - -
- 2041151..2041212 + 62 NuclAT_31 - -
- 2041151..2041212 + 62 NuclAT_31 - -
- 2041151..2041212 + 62 NuclAT_31 - -
- 2041151..2041212 + 62 NuclAT_31 - -
- 2041151..2041213 + 63 NuclAT_51 - -
- 2041151..2041213 + 63 NuclAT_51 - -
- 2041151..2041213 + 63 NuclAT_51 - -
- 2041151..2041213 + 63 NuclAT_51 - -
- 2041151..2041213 + 63 NuclAT_54 - -
- 2041151..2041213 + 63 NuclAT_54 - -
- 2041151..2041213 + 63 NuclAT_54 - -
- 2041151..2041213 + 63 NuclAT_54 - -
- 2041151..2041213 + 63 NuclAT_57 - -
- 2041151..2041213 + 63 NuclAT_57 - -
- 2041151..2041213 + 63 NuclAT_57 - -
- 2041151..2041213 + 63 NuclAT_57 - -
- 2041151..2041214 + 64 NuclAT_34 - -
- 2041151..2041214 + 64 NuclAT_34 - -
- 2041151..2041214 + 64 NuclAT_34 - -
- 2041151..2041214 + 64 NuclAT_34 - -
- 2041151..2041214 + 64 NuclAT_37 - -
- 2041151..2041214 + 64 NuclAT_37 - -
- 2041151..2041214 + 64 NuclAT_37 - -
- 2041151..2041214 + 64 NuclAT_37 - -
- 2041151..2041214 + 64 NuclAT_40 - -
- 2041151..2041214 + 64 NuclAT_40 - -
- 2041151..2041214 + 64 NuclAT_40 - -
- 2041151..2041214 + 64 NuclAT_40 - -
- 2041151..2041214 + 64 NuclAT_43 - -
- 2041151..2041214 + 64 NuclAT_43 - -
- 2041151..2041214 + 64 NuclAT_43 - -
- 2041151..2041214 + 64 NuclAT_43 - -
- 2041151..2041214 + 64 NuclAT_46 - -
- 2041151..2041214 + 64 NuclAT_46 - -
- 2041151..2041214 + 64 NuclAT_46 - -
- 2041151..2041214 + 64 NuclAT_46 - -
- 2041151..2041214 + 64 NuclAT_49 - -
- 2041151..2041214 + 64 NuclAT_49 - -
- 2041151..2041214 + 64 NuclAT_49 - -
- 2041151..2041214 + 64 NuclAT_49 - -
A9K64_RS10325 2041527..2041634 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2041681..2041747 + 67 - - Antitoxin
A9K64_RS10330 2042039..2043139 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
A9K64_RS10335 2043409..2043639 + 231 WP_001146442.1 putative cation transport regulator ChaB -
A9K64_RS10340 2043797..2044492 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
A9K64_RS10345 2044536..2044889 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
A9K64_RS10350 2045074..2046468 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T64060 WP_000170965.1 NZ_CP015995:c2041634-2041527 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T64060 NZ_CP015995:c2041634-2041527 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT64060 NZ_CP015995:2041681-2041747 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References