Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 53270..53484 | Replicon | plasmid Efsorialis-p2 |
Accession | NZ_CP015885 | ||
Organism | Enterococcus faecalis strain sorialis |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | A6B47_RS15280 | Protein ID | WP_002360667.1 |
Coordinates | 53270..53380 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 53420..53484 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6B47_RS15235 | 48670..48984 | + | 315 | WP_002401837.1 | hypothetical protein | - |
A6B47_RS15240 | 49187..49807 | + | 621 | WP_002366000.1 | recombinase family protein | - |
A6B47_RS15245 | 49797..50111 | + | 315 | WP_025190469.1 | hypothetical protein | - |
A6B47_RS15250 | 50105..50329 | + | 225 | WP_002414746.1 | hypothetical protein | - |
A6B47_RS15255 | 50390..50599 | + | 210 | WP_002399367.1 | hypothetical protein | - |
A6B47_RS15260 | 50611..50913 | + | 303 | WP_002393766.1 | hypothetical protein | - |
A6B47_RS15265 | 51341..52672 | + | 1332 | WP_087548826.1 | Y-family DNA polymerase | - |
A6B47_RS15270 | 52669..53019 | + | 351 | WP_002399364.1 | hypothetical protein | - |
A6B47_RS15280 | 53270..53380 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 53420..53484 | - | 65 | - | - | Antitoxin |
A6B47_RS15285 | 53620..53916 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
A6B47_RS15290 | 54170..54952 | + | 783 | WP_002360664.1 | ParA family protein | - |
A6B47_RS15295 | 54945..55301 | + | 357 | WP_002360663.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..55548 | 55548 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T63883 WP_002360667.1 NZ_CP015885:53270-53380 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T63883 NZ_CP015885:53270-53380 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT63883 NZ_CP015885:c53484-53420 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|