Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 457679..457873 | Replicon | chromosome |
Accession | NZ_CP015883 | ||
Organism | Enterococcus faecalis strain sorialis |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | A6B47_RS15330 | Protein ID | WP_015543884.1 |
Coordinates | 457778..457873 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 457679..457743 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6B47_RS02315 | 453312..455054 | + | 1743 | WP_002399652.1 | PTS transporter subunit EIIC | - |
A6B47_RS02320 | 455045..457078 | + | 2034 | WP_087548534.1 | transcription antiterminator | - |
A6B47_RS02325 | 457089..457523 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 457679..457743 | + | 65 | - | - | Antitoxin |
A6B47_RS15330 | 457778..457873 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
A6B47_RS02335 | 458119..459891 | + | 1773 | WP_010706745.1 | PTS mannitol transporter subunit IICBA | - |
A6B47_RS02340 | 459906..460343 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
A6B47_RS02345 | 460358..461512 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
A6B47_RS02350 | 461579..462694 | - | 1116 | WP_002379062.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T63857 WP_015543884.1 NZ_CP015883:c457873-457778 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T63857 NZ_CP015883:c457873-457778 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT63857 NZ_CP015883:457679-457743 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|