Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
| Location | 3741576..3741797 | Replicon | chromosome |
| Accession | NZ_CP015853 | ||
| Organism | Escherichia coli strain ATCC 43889 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | A8714_RS19095 | Protein ID | WP_001295224.1 |
| Coordinates | 3741690..3741797 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3741576..3741641 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A8714_RS19070 | 3737017..3737919 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| A8714_RS19075 | 3737930..3738913 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| A8714_RS19080 | 3738910..3739914 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| A8714_RS19085 | 3739944..3741214 | - | 1271 | Protein_3614 | transporter | - |
| - | 3741576..3741641 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 3741576..3741641 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 3741576..3741641 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 3741576..3741641 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 3741576..3741641 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 3741576..3741641 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 3741576..3741641 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 3741576..3741641 | - | 66 | NuclAT_21 | - | Antitoxin |
| A8714_RS19095 | 3741690..3741797 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| A8714_RS19100 | 3741884..3743563 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| A8714_RS19105 | 3743560..3743751 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| A8714_RS19110 | 3743748..3745319 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| A8714_RS19115 | 3745592..3745780 | + | 189 | WP_001063316.1 | YhjR family protein | - |
| A8714_RS19120 | 3745792..3745989 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
| A8714_RS19125 | 3746008..3746544 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T63810 WP_001295224.1 NZ_CP015853:3741690-3741797 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T63810 NZ_CP015853:3741690-3741797 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT63810 NZ_CP015853:c3741641-3741576 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|