Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1522023..1522248 | Replicon | chromosome |
| Accession | NZ_CP015853 | ||
| Organism | Escherichia coli strain ATCC 43889 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | A8714_RS08605 | Protein ID | WP_000813263.1 |
| Coordinates | 1522023..1522178 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1522190..1522248 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A8714_RS08570 | 1517477..1518190 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| A8714_RS08575 | 1518328..1518524 | - | 197 | Protein_1611 | TrmB family transcriptional regulator | - |
| A8714_RS08580 | 1518811..1519629 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| A8714_RS08585 | 1519781..1520152 | - | 372 | WP_000090264.1 | antitermination protein | - |
| A8714_RS08590 | 1520142..1520513 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A8714_RS08595 | 1520526..1521575 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| A8714_RS08600 | 1521577..1521855 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| A8714_RS08605 | 1522023..1522178 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 1522190..1522248 | + | 59 | - | - | Antitoxin |
| A8714_RS08620 | 1522783..1523556 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| A8714_RS08625 | 1523908..1524321 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| A8714_RS08630 | 1524337..1525107 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| A8714_RS08635 | 1525129..1525875 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
| A8714_RS08640 | 1525882..1526973 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T63798 WP_000813263.1 NZ_CP015853:c1522178-1522023 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T63798 NZ_CP015853:c1522178-1522023 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT63798 NZ_CP015853:1522190-1522248 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|